RetrogeneDB ID:
retro_mputfur_798
Organism:
Location:
GL896949.1:2551752-2552077 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
67.26 %
Coverage:
76.55 %
Frameshifts:
2
Stop codons:
3


Parental gene:
Parental gene symbol:
PPP1R14B
Parental gene aliases:
No gene alias available
Parental gene description:
protein phosphatase 1, regulatory (inhibitor) subunit 14B [Source:HGNC Symbol;Acc:9057]

Genomic region (view in browser)





>retro_mputfur_798
GCAGGTGAAGGTCCCAGGGTGCAGACCAGGAGAGCCCAGTGAGGCACCAAGGGAAGGTCG
TTGTCAAATAGGACCATGAGAAGCTGGGGAAGTACCTTGACATAGAGGAGTGAATTCTGG
GGCAGCTCACTCACCTCTATAACTTCCAGGAAGAGATCCCAGAATTAGAATTTGATGTAG
ATGAACTCTTGAATGTGGAGAGTGATAATACCATGCCTGCCAGGGTCAAGGAGTAGCTGG
GTGACTGTGATAAACCCACTGGGGCCTTCCTTGGACTACTGGACAAGACCTGGGGAATGC
AGAACCGAGCACACCCCAGAAGAAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AGEGPG-GADDEGPVRRQGKVTVKYDRKELRKRLNLEEWILEQLTRLYDCQEEEIPELEIDVDELLDMESDDTRAARVKELLVDCYKPTEAFISGLLDKI
AGEGP..GAD.E.PVR.QGKV.VK.D...L.K.L..EE.IL.QLT.LY..Q.EEIPELE.DVDELL..ESD.T..ARVKE.L.DC.KPT.AF..GLLDK.
Retrocopy
AGEGPR/GADQESPVRHQGKVVVK*DHEKLGKYLDIEE*ILGQLTHLYNFQ-EEIPELEFDVDELLNVESDNTMPARVKE*LGDCDKPTGAFL-GLLDKT


Parental protein
RGMQ-KLSTPQKK
.GMQ...STPQKK
Retrocopy
WGMQ/EPSTPQKK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide