RetrogeneDB ID:
retro_mputfur_800
Organism:
Location:
GL896949.1:12350491-12351185 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
54.58 %
Coverage:
75.4 %
Frameshifts:
2
Stop codons:
3


Parental gene:
Parental gene symbol:
DPPA4
Parental gene aliases:
No gene alias available
Parental gene description:
developmental pluripotency associated 4 [Source:HGNC Symbol;Acc:19200]

Genomic region (view in browser)





>retro_mputfur_800
GAACTCCACAAAAAGAAGTCATGGGAAGAACATCTAACTTGCAAACCCCAACTTGTGTCA
GGAAAAGTAAAAGAGAAACAGCAGGCTTCTAGTACACCAAAGTTAACAACCTTAGAGAAT
GGGACCAGAAGGAAAAGATCTATGAAAGACAAAACTTCCTATTCAGAAAGGACAACATAA
GGCAATCGAAGAGTGAGGCTTCAGAAGAAGATACTGATTCCTCTAGTACCTTCCAAACTA
CTACCAGCCAATCTGCTTCACCGAGACATCTTTTGCTCTGGTACCAAGAACCGAAGCACC
ACAGACCAGAAATGAGATGCAGTTAAATGACTCTGCAAATATGCTTACCCTGATCGAAAA
ATGAACATTCCTGTCATTGCAAAGGAGGCCAGGATTGTCACAGGGTCACAAAGGAGTTCA
AAGATAGATAATGGGGAAATGTCCCTGGAAAGTTTCTGGGGGAAAAGGGTATCTTCTGAT
GGAGATACCTTCAGGAAGTGGCTGCTCCCCCTGAGGATGGAGGGTGTCTGTCCTTGTTGG
GTCTAATGATCTCCTAAAGAGAGTTGATACTGTTGTGACAGCTTCAGCTCCAGAAGCTGC
ATTTGCTACCAGGTCCAGAATTGCAACCAGGATGGGGAAGATGGAGACAGGGGAATCAGC
ACAGGAAGCCTATGGGCTCAGGCAGTGCACAGTC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KLRKRSGWKEWGLSEP--ASEETREKQQAPGEPKLQKTSASGTKRKRSMKEDKASCSEKKEEGSGKVRLRKKIPVPPLPLKLPPANMLHRDVLRAWCQQL
.L.K...W.E.....P...S....EKQQA...PKL..T...GT.RKRSMK.DK.S.SE....G...VRL.KKI..P..P.KL.PAN.LHRD.....C...
Retrocopy
ELHKKKSWEEHLTCKPQLVSGKVKEKQQASSTPKLT-TLENGTRRKRSMK-DKTSYSERTT*GNRRVRLQKKILIPLVPSKLLPANLLHRDI---FCSGT


Parental protein
K-LSTKGQKLDVYKRICEYAYPDQQKNIPVTAEEAKILSQSQRRSKMEQGEMSLEGF-GKRVSSDG-TYPPEVAAPPE-GGAPTSVG-SGALLEGVDTVV
K..ST..QK.D..K..C.YAYPD...NIPV.A.EA.I...SQR.SK...GEMSLE.F.GKRVSSDG..Y..EVAAPPE.GG.....G.S..LL..VDT.V
Retrocopy
KNRSTTDQK*DAVK*LCKYAYPDRKMNIPVIAKEARIVTGSQRSSKIDNGEMSLESFWGKRVSSDG/RYLQEVAAPPEDGGCLSLLG/SNDLLKRVDT-V


Parental protein
VTTSAPDAVFASWSRIAGRAGMTETVESPQEAHGVRWCVV
VT.SAP.A.FA..SRIA.R.G..ET.ES.QEA.G.R.C.V
Retrocopy
VTASAPEAAFATRSRIATRMGKMETGESAQEAYGLRQCTV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide