RetrogeneDB ID:
retro_mputfur_803
Organism:
Location:
GL896949.1:10741810-10742127 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
73.83 %
Coverage:
68.39 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
FXN
Parental gene aliases:
No gene alias available
Parental gene description:
frataxin [Source:HGNC Symbol;Acc:3951]

Genomic region (view in browser)





>retro_mputfur_803
TGTTTGATGACTCTGAGGACAGTGGGAACTTTGGGCGAGCCTGACAGTCTAGATGCGACC
ACCTATGAAAGCTGGCAGAGAAGACACCGGACTCTCTAGCAGAGTTTGTTGAAGACCTCG
CAGACAAACCTTACTCATTCTAAGTCTATGATGTCTCGTGTGGGAGTGGTGTTTTAACAG
TTACGCTAGGTGGAGATCTAGGAAGCTATGTGATCAACATGCAGACCCCAAACAAGCAAA
TCTGGTTGTCTTCACACTGCAGTGGGCCCAAGGCCTATGACTGGACTAGGAAGAACTGGG
TGTTCCCCCCACAGGGT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
CWVTVRAVGTVGDPGSLDETTYE-RLAEKTLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGRN
C..T.R.VGT.G.P.SLD.TTYE..LAEKT.DSLAEF.EDLADKPY.F..YDVS.GSGVLTV.LGGDLG.YVIN.QTPNKQIWLSS..SGPK.YDWT..N
Retrocopy
CLMTLRTVGTLGEPDSLDATTYE/KLAEKTPDSLAEFVEDLADKPYSF*VYDVSCGSGVLTVTLGGDLGSYVINMQTPNKQIWLSSHCSGPKAYDWTRKN


Parental protein
WVYAHDG
WV....G
Retrocopy
WVFPPQG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide