RetrogeneDB ID:
retro_mputfur_805
Organism:
Location:
GL896950.1:697873-698471 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
71.64 %
Coverage:
70.67 %
Frameshifts:
1
Stop codons:
4


Parental gene:
Parental gene symbol:
NIT2
Parental gene aliases:
No gene alias available
Parental gene description:
nitrilase family, member 2 [Source:HGNC Symbol;Acc:29878]

Genomic region (view in browser)





>retro_mputfur_805
ATGGTGCTACGTCGGAGAGCCATGGCCTCTTTTCATTTGGTCCTCATCCAACTTCAGGTT
TCTTTCATCAAATCAGATAACCTCACTCAAGCCTGTGGCCTTGTCTGGGAGGCAGCAAGA
GGAGGAGCCAAAATAGTTGCTCTTCCAGAGTGCTTTAATTCTTAAATTTGGTATGAAATA
TTTTCCTGAATATGCAGAGAGAATACCTGGTGAATCCACACAGAAGCTTTCTGAAGTAGC
AAAGGAGTGCAGCATATAGCTCATTGGAGTTTCCATTCTTGAAGAGGATGCTGGGAGATT
ATTTAACACCTGTGCTGTGTTTAGACCTGATGGAACTTTACAGGTAGAGCACAGAAAGCT
CCATCTGTTTGACATCGGTGTTTCCGGGAAAATTACATTACAAGAATCTAAAACATTGAG
TCCTGGTGATAGTTTTTCCACAATTGATGCTCCTTACTGCTGAATAGGCCTGGGCATCTG
CTATGACACTGCTTTGTAGAGCTTGTGCAAATCTACATAGAGGGGCTGGCAGCTGTTAGT
CTATTCTGGAGCTTTTAATTTGACTTCCGGACCAGCCCACTGGGACAGAACTGAAAAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MVLPGRAMATFRLALIQLQVSSVKSDNVTRACGLVQEAAAQGAKIVSLPECFNS-PYGTKYFPEYAEKIPGESTQKLSEVAKECGIYLIGGSIPEEDAGK
MVL..RAMA.F.L.LIQLQVS..KSDN.T.ACGLV.EAA..GAKIV.LPECFNS...G.KYFPEYAE.IPGESTQKLSEVAKEC.I.LIG.SI.EEDAG.
Retrocopy
MVLRRRAMASFHLVLIQLQVSFIKSDNLTQACGLVWEAARGGAKIVALPECFNS\KFGMKYFPEYAERIPGESTQKLSEVAKECSI*LIGVSILEEDAGR


Parental protein
LYNTCTVFGPDGTLLVKYRKLHLFDIDVPGKITFQESETLSPGDSFSTFDTPYCRVGLGICYDMRFAELAQVYAQRGCQLLVYPGAFNMTTGPAHWELLQ
L.NTC.VF.PDGTL.V..RKLHLFDI.V.GKIT.QES.TLSPGDSFST.D.PYC..GLGICYD.....L......RG.QLLVY.GAFN.T.GPAHW....
Retrocopy
LFNTCAVFRPDGTLQVEHRKLHLFDIGVSGKITLQESKTLSPGDSFSTIDAPYC*IGLGICYDTAL*SLCKS-T*RGWQLLVYSGAFNLTSGPAHWDRTE


Parental protein
R
.
Retrocopy
K


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide