RetrogeneDB ID:
retro_mputfur_807
Organism:
Location:
GL896950.1:8778552-8779291 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
75.5 %
Coverage:
55.63 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
TUBB
Parental gene aliases:
No gene alias available
Parental gene description:
tubulin, beta class I [Source:HGNC Symbol;Acc:20778]

Genomic region (view in browser)





>retro_mputfur_807
ACATTTCATCCAGATGGCCCACAGGCACATGACCACATCTCCTTGTACTACAATGAAGCT
ACAGGTGGCAAATATGTTCCTTGTGCTATATTGGTGGATCTAGAACCCAGGACCATGGAC
TCTGTTCCCTCAGGGCCTCTTGGGCAGATATTCAGACCAGACAGCTTTGTTTTTGATCAG
TCAAAGAAGGTAACAACTGAGCCAAGGGCCATTGTACAGAGAGGGCTGAGCTGGTTGACT
CAGTCCTGGATATGGTGAGGAAGGGGGCCAAGAGCTGTGACTGCCTGAAGGCCTTCCAGC
TGACCCACTCCCTGGGTGGGGGCACAGGCTCTGGAACGGTCACCTTGCTCATCAGCAAGA
TCCAAAAAGAGTATCCCAACTGTATCATGAACACCTTCAGTGTGGTACTCTCACCCAAAG
CATCTGACACAGTGGTCACACCCTACAATGTCATCTTTTCCATCCATCAGTTGCTAGAGA
ACACAGATGAGACCTACTGCTTTGACAATGAGGCCCTTTATGACATCTGCTTCTGTACTC
TCAAGCTGACCATGCCAACCTACAGGGACCTGAACCACCTTGTCTCAGCCACCATGAGCG
ATCTCAACACGTGCCTCTGCTTCCCTGATCAGCTCAGTGCTGACCTCCACAAGCTAGCCA
ACAGCATGTTGCCCTTTACATCTCTTCACTTCTTCATGCCTGGCTTTGCACTCTGACCAG
CCATGGAAGCCAGCAATAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGA-GNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGF
T.H.D.....D.IS.YYNEATGGKYVP.AILVDLEP.TMDSV.SGP.GQIFRPD.FVF.QS...GNN.AKGH.TE.AELVDSVLD.VRK.A.SCDCL..F
Retrocopy
TFHPDGPQAHDHISLYYNEATGGKYVPCAILVDLEPRTMDSVPSGPLGQIFRPDSFVFDQSKK/GNN*AKGHCTERAELVDSVLDMVRKGAKSCDCLKAF


Parental protein
QLTHSLGGGTGSGMGTLLISKIREEYPDRIMNIFSVVPSPRVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATM
QLTHSLGGGTGSG..TLLISKI..EYP..IMN.FSVV.SP..SDTVV.PYN...S.HQL.ENTDETYC.DNEALYDICF.TLKLT.PTY.DLNHLVSATM
Retrocopy
QLTHSLGGGTGSGTVTLLISKIQKEYPNCIMNTFSVVLSPKASDTVVTPYNVIFSIHQLLENTDETYCFDNEALYDICFCTLKLTMPTYRDLNHLVSATM


Parental protein
SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFA-PLTSRGSQQY
S...TCL.FP.QL.ADL.KLA..M.PF..LHFFMPGFA..LTS.GSQQY
Retrocopy
SDLNTCLCFPDQLSADLHKLANSMLPFTSLHFFMPGFA/TLTSHGSQQY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide