RetrogeneDB ID:
retro_mputfur_808
Organism:
Location:
GL896950.1:9416390-9417556 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
96.67 %
Coverage:
95.81 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
PSAT1
Parental gene aliases:
No gene alias available
Parental gene description:
phosphoserine aminotransferase 1 [Source:HGNC Symbol;Acc:19129]

Genomic region (view in browser)





>retro_mputfur_808
CAAATACCAGCCACGCACGCTTCTCTCCGTTGTCCTTGTCGCCTACGCTGCCGCCCCATG
AGCGCCCCGACGCAGGTGGTCAACTTCGGGCCCGGGCCTGCCAAGCTACCGCGCTCGGTA
TTGTTAGAGAGCCAAAAAGAACTATTAGACTACAAAGGAACTGGGATTAGTGTTTTTGAA
ATGAGCCACAGATCGTCGGATTTTGCCAAGATTATTAACAACGCAGAGAATCTTGTGCGG
GAATTGTTAGCCATTCCAGATAACTACAAGGTGATTTTTGTGCAAAGAGGTGGGTCTGGC
CAGTTCAGTGCTGTCCCCTTAAACCTGATTGGCCGGAAAGCAGGAAGGTGTGCTGACTAC
GTGATAACTGGCTCTTGGTCAGCTAAGGCCGCAGAAGAAGCCAAGAAGTTCGGGACTGTG
AATATCGTCCACCCCAAACTTGGGAGTTACACGAAAATCCCAGATCCAAGCACCTGGAAC
CTCAGCCCGGACGCTTCCTATGTGTATTACTGCGCTAACGAGACCGTGCACGGAGTGGAG
TTTGACTTTATCCCTGATGTCAAGGGGGCAGTGCTGGTTTGCGACATGTCCTCAAACTTC
CTCTCCAAGCCAGTGATGTTTCCAAGTTCGGCGTGATTTTTGCCGGTGCACAGAAGAACG
TGGGCTCTGCGGGGGTCACCGTAGTGATCATCCGCGAGGAACTGCTGGGGTTCGCGCTCC
GAGAGTGCCCCTTGATCCTGGAATACAAAGTACAGGCTGCAAACAGCTCCTTGTACAACA
CGCCCCCGTGCTTCAGCATCTACGTCATGGGCTTGGTCCTGGAGTGGATTAAGAACAATG
GCGGGGCCGCAGCCATGGAGAAGCTCAGCGCCATCAAATCGCAGATGATTTATGATATTA
TTGATAATTCTCAAGGATTCTATGTATGTCCAGTGGAGCCCAAGTATAGAAGCAAGATGA
ATATTCCATTCCGCATTGGCAATGCCAAAGGAGACGATGCTTTAGAAAAAAGATTTCTTG
ATAAAGCTCTTGAACTCAATATGATCTCCTTGAAAGGACATAGGTCTGTGGGAGGCATCC
GGGCCTCTCTGTATAATGTTGTCACGATTGAGGATGTTCAAAAGCTGGCGGCCTTCATGA
AGAACTTTCTGGAGATGCATCAGCTA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QTRAAHASLRCPCRLRCRTMSAPTQVVNFGPGPAKLPRSVLLEIQKELLDYKGIGISVLEMSHRSSDFAKIINNAENLVRELLAIPDNYKVIFVQGGGSG
Q..A.HASLRCPCRLRCR.MSAPTQVVNFGPGPAKLPRSVLLE.QKELLDYKG.GISV.EMSHRSSDFAKIINNAENLVRELLAIPDNYKVIFVQ.GGSG
Retrocopy
QIPATHASLRCPCRLRCRPMSAPTQVVNFGPGPAKLPRSVLLESQKELLDYKGTGISVFEMSHRSSDFAKIINNAENLVRELLAIPDNYKVIFVQRGGSG


Parental protein
QFSAVPLNLIGRKAGRCADYVVTGSWSAKAAEEAKKFGTVNIVHPKLGSYTKIPDPSTWNLSPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNF
QFSAVPLNLIGRKAGRCADYV.TGSWSAKAAEEAKKFGTVNIVHPKLGSYTKIPDPSTWNLSPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNF
Retrocopy
QFSAVPLNLIGRKAGRCADYVITGSWSAKAAEEAKKFGTVNIVHPKLGSYTKIPDPSTWNLSPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNF


Parental protein
LSKPV-DVSKFGVIFAGAQKNVGSAGVTVVIIREDLLGFALRECPSILEYKVQAANSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSAIKSQMIYD
LSKPV.DVSKFGVIFAGAQKNVGSAGVTVVIIRE.LLGFALRECP.ILEYKVQAANSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSAIKSQMIYD
Retrocopy
LSKPV/DVSKFGVIFAGAQKNVGSAGVTVVIIREELLGFALRECPLILEYKVQAANSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSAIKSQMIYD


Parental protein
IIDNSQGFYVCPVEPKYRSKMNIPFRIGNAKGDDALEKRFLDKALELNMISLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKNFLEMHQL
IIDNSQGFYVCPVEPKYRSKMNIPFRIGNAKGDDALEKRFLDKALELNMISLKGHRSVGGIRASLYN.VTIEDVQKLAAFMKNFLEMHQL
Retrocopy
IIDNSQGFYVCPVEPKYRSKMNIPFRIGNAKGDDALEKRFLDKALELNMISLKGHRSVGGIRASLYNVVTIEDVQKLAAFMKNFLEMHQL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide