RetrogeneDB ID:
retro_mputfur_810
Organism:
Location:
GL896950.1:11448649-11449318 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
78.32 %
Coverage:
92.95 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
Phosphatidylinositol glycan anchor biosynthesis, class F [Source:UniProtKB/TrEMBL;Acc:G9KGH7]

Genomic region (view in browser)





>retro_mputfur_810
GCCTCTCAAAACACTGTAAAAGATAACTGATAGCAAGAGACTACTGCATACCCATCTTTT
ATGCAGATTTTCAATTATCCTGAGCATCTTCAGTCCATCATTCTTCTTGGAGAACTTTTC
AATATTGGAAACACACTTGACATGGTTGGGCATCTGTTCTGTTTTTGTAACTGCCGTCAA
GCTAGTATTATATTTAGTAGTGAAACCAAATACATCCATTAAAAGAAGTTCATTATCATA
CAAGATGACCAGATTTTTGAAATGCTGTATCTAATTTCTTATGTGATGTTTCTTCTTTCA
CATAAATTTTGTTCTACATGGAGTACCACTCACAGAGTTGGTGTTGGAAACTATTTATTT
GCAGTTATTTTGTCTACTTTTATTACTGTACCTTTTTCATGTTTGTTAGAACCAAACATC
AAAGCATGGTTAAGAATTTTCAGTAGAAATGGAGTCACCATTTGGGGTAACAGTCTTCAG
ATCATTACAATTTCTAGCTCTATAGGAACATGGCCTGGAGCCTTTTCTAGTGCACTCAAT
TGGGAAAGACTGTCGCAGATACGGCCCTTCTCCTGTACACTTGGAGTGACTTTTGGCTAC
ATGGCTGGCCTTGTGATTTCACCACTGTGGATACACTGTAATAAAAAGCAACTTACATAC
AAGAACAAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SQENTMKD-TDIKRLLYTHLLCIFSIILSIFIPSFFLENFSILETHLTWLCICSVFVTAVNLVLYLVVKPNASSKRSSLSYKVVRFLKCCIYFLMSCFFF
...NT.KD.TD.KRLL.THLLC.FSIILSIF.PSFFLENFSILETHLTWL.ICSVFVTAV.LVLYLVVKPN.S.KRSSLSYK..RFLKCCI.FLM.CFFF
Retrocopy
ASQNTVKD\TDSKRLLHTHLLCRFSIILSIFSPSFFLENFSILETHLTWLGICSVFVTAVKLVLYLVVKPNTSIKRSSLSYKMTRFLKCCI*FLM*CFFF


Parental protein
HVIFVLYGAPLIELVLET-FLFAVTLSTFTTVPCLCLLGPNIKAWLRVFSRNGVTSIWENSLQITTISSFIGTWLGAFPIPLDWERPWQVWPISCTLGAT
H..FVL.G.PL.ELVLET..LFAV.LSTF.TVP..CLL.PNIKAWLR.FSRNGVT.IW.NSLQI.TISS.IGTW.GAF...L.WER..Q..P.SCTLG.T
Retrocopy
HINFVLHGVPLTELVLET/YLFAVILSTFITVPFSCLLEPNIKAWLRIFSRNGVT-IWGNSLQIITISSSIGTWPGAFSSALNWERLSQIRPFSCTLGVT


Parental protein
FGYVAGLVISPLWIYWNRKQLTYKNN
FGY.AGLVISPLWI..N.KQLTYKNN
Retrocopy
FGYMAGLVISPLWIHCNKKQLTYKNN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide