RetrogeneDB ID:
retro_mputfur_814
Organism:
Location:
GL896950.1:11647129-11647471 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
76.32 %
Coverage:
99.12 %
Frameshifts:
0
Stop codons:
3


Parental gene:
Parental gene symbol:
ATP5G2
Parental gene aliases:
No gene alias available
Parental gene description:
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9) [Source:HGNC Symbol;Acc:842]

Genomic region (view in browser)





>retro_mputfur_814
ACTCTCTTCTTGGTCAGGAGCACCTCTCAACTGTTGAGTGGATCACTGTCTGCAGTGGTG
CTAAAACCACCAGAGACAAGGACAGATGACAGCCTCAGCAACTTAGCAGCCCCACATCCC
CCTCACCTCACTTATTCCTAGTCACAGCTTCCAAACCCCAGCACCATTTCAAGGGACATC
GACACAGCAGACAAGTTCATAGGGGCTGGGGCTGCCACGGTAGAGGTGGCTGGCTCTGGG
GCTGGAATTGGGACTGTGTTTGGGACCCTCACCATTGGTTAGGCCAGGAACCCCTCTCTG
AAGCAACAGCTCTTCTCCTAGGCCATTCTGGGTTTTGTTCTC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TPFLVRSTSQLLSRSLSAVVLKPPETLTDEGLSILAAPR-PLTSLIPSRSFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSL
T.FLVRSTSQLLS.SLSAVVLKPPET.TD..LS.LAAP..P......S.....S.ISRDIDTA.KFIGAGAATV.VAGSGAGIGTVFG.L.IG.ARNPSL
Retrocopy
TLFLVRSTSQLLSGSLSAVVLKPPETRTDDSLSNLAAPHPPHLTYS*SQLPNPSTISRDIDTADKFIGAGAATVEVAGSGAGIGTVFGTLTIG*ARNPSL


Parental protein
KQQLFSYAILGFAL
KQQLFS.AILGF.L
Retrocopy
KQQLFS*AILGFVL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide