RetrogeneDB ID:
retro_mputfur_815
Organism:
Location:
GL896951.1:282105-283415 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
93.61 %
Coverage:
99.32 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
PSMC1
Parental gene aliases:
No gene alias available
Parental gene description:
proteasome (prosome, macropain) 26S subunit, ATPase, 1 [Source:HGNC Symbol;Acc:9547]

Genomic region (view in browser)





>retro_mputfur_815
ATGGGTCAGAGTCAGAGCGGTGGTCATGGCCCTGGAGGTGGCAAGAAGGATGACAAGGAC
AAGAAAAAGAAATATGAACCTCCTGTACCAACTCGGGTGGGGAAAAAGAAGAAGAAAACA
AAGGGACCAGATGCTGCCAGCAAGCTGCCACTGGTGATACCCCATACTCAGGGCCAGTTA
AAATTATTGAAGTTAGAGAGAATTAAAGACTATCTTCTCATGGAGGAAGAATTCATTAGA
GTCAGGAACAAATGAAGCCTTTAGAAGAAAAGCAAGAGGAGGAAAGGTCTAAGATGGATG
ACCTGAGAGGGAACCCAATGTCAGTAGGAACCTTGGAAGAGATCATTGATGACAATCACA
CCATCGTGTCTACATCTGTGAGCTCTGAGCAATACCTCAGCATTCTTTCCTTTGTAGACA
AGGATCTGCTGGAACCGGGCTGCTCCGTCCTGCTCAACCAGAAGGTACATCCCGTCATAG
GGGTGTTTATGGACGACACAGATCCCTTGGTCACAGTGATGAAGGTAGAAAAGGTGCCCC
AGGAAACCTATGTTGATATTGGGGGGTTGGACAACCAAATCCAGGAAATTAAGGAATCTG
TGGAGCTTCCTCTCACTCATCCTGAGTATTATGAAGAGATGGGTATAAAGCCCCCGAAGG
GGGTCATTCTCTATGGTCCACCTGGCACAGGTAAAACCTTATTAGCCAAAACAGTAGCAA
ACCAAACCTCAGCCACTTTATTGAGAGTGTTTGGCTTGGAACTTATTCAGAAGTACCTAG
GTGACGGGCCCAAACTCATTCGGGAATTGTTTCGAGTTGCGGAAGAACACGCACCATCCA
TCATGTTCATTGATGAAATTGATGCCATTGGAACAAAAAGGTATGACTCAAATTCTGGTT
GTGAGAGAGAAATTCAGCGAACAATGCTGGAGCTGCTGAACCAGTTGGATGGATTTGATT
CGAGGGGTGACGAGAAAGTTATCATGGCCACAAACCGAATAGAGACTTTGGATCCAGCTC
TTATCAGACCAGGTCGCATCGATAGGAAGATTGAGTTCCCCCTGCCGGAAGAGAAGACTA
AGAAGCGCATCTTTCAAATCCACACAAGCAGGATGACGCTGACCGATGATGTGATCCTGG
ACGACTTGATCATGGCTAAAGATGACCTCTCGGATGCTGATATCAAGGCAATCTGTACAG
AAGCTGGTCTGATGGCCTTGAGAGAACGCAGAATGAAAGTAACAAATGAAGACTTCAAGA
AATCTAAAGAAAATGTTCTTTATAAAAAACAGGAAGGCACCCCTGAGGGA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIR-NQEQMKPLEEKQEEERSKV
MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLV.PHTQ..LKLLKLERIKDYLLMEEEFIR..QEQMKPLEEKQEEERSK.
Retrocopy
MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVIPHTQGQLKLLKLERIKDYLLMEEEFIR/SQEQMKPLEEKQEEERSKM


Parental protein
DDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKE
DDLRG.PMSVGTLEEIIDDNH.IVSTSV.SE.Y.SILSFVDKDLLEPGCSVLLN.KVH.VIGV.MDDTDPLVTVMKVEK.PQETY.DIGGLDNQIQEIKE
Retrocopy
DDLRGNPMSVGTLEEIIDDNHTIVSTSVSSEQYLSILSFVDKDLLEPGCSVLLNQKVHPVIGVFMDDTDPLVTVMKVEKVPQETYVDIGGLDNQIQEIKE


Parental protein
SVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNS
SVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAK.VANQTSAT.LRV.G.ELIQKYLGDGPKL.RELFRVAEEHAPSI.FIDEIDAIGTKRYDSNS
Retrocopy
SVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKTVANQTSATLLRVFGLELIQKYLGDGPKLIRELFRVAEEHAPSIMFIDEIDAIGTKRYDSNS


Parental protein
GGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAIC
G.EREIQRTMLELLNQLDGFDSRGD.KVIMATNRIETLDPALIRPGRIDRKIEFPLP.EKTKKRIFQIHTSRMTL.DDV.LDDLIMAKDDLS.ADIKAIC
Retrocopy
GCEREIQRTMLELLNQLDGFDSRGDEKVIMATNRIETLDPALIRPGRIDRKIEFPLPEEKTKKRIFQIHTSRMTLTDDVILDDLIMAKDDLSDADIKAIC


Parental protein
TEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEG
TEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEG
Retrocopy
TEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide