RetrogeneDB ID:
retro_mputfur_821
Organism:
Location:
GL896952.1:4103712-4104188 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
99.38 %
Coverage:
51.46 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
TOMM34
Parental gene aliases:
No gene alias available
Parental gene description:
translocase of outer mitochondrial membrane 34 [Source:HGNC Symbol;Acc:15746]

Genomic region (view in browser)





>retro_mputfur_821
CCTGTCACAGCTCAGAAGAGGTGGGATTCCTCACCTTTGGAGTACCACAAAGAGAACACT
AAGGGCAAATTCAGAGAAGCCACAACCACCAAGGGCAGAGTGTCTTCTGCTGGGGATGTG
GAGAGAGCCAGAATTCTGAAGGAAGAAGGCAATGAGCTTGTAAAGAAGGGAAACCATAAG
AAAGCTATTGAGAAGTACAGTGAAAGCCTGTCCTTTAGTGACATAGAGTCCGCCACATAC
AGCAACAGAGCGCTCTGCCATTTGGCCCTGAAGCAGTACAAGGAAGCAGTGAGGGACTGC
ACAGAAGCCCTCAGGCTGGATGGAAAGAACGTGAAGGCGTTCTACAGACGAGCGCAAGCC
TACAAGGCACTCAAGACTACAAATCCAGCTTTGAAGACATCAACAGTCTTCTGCAGCTTG
AACCGAGAAACGGCCCTGCCCAGAAGTTGCAGCAGGAAGTTAACCAGAGCTTAAAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PVTAQKRWDSSPLEYHKENTKGKFREATTTKGRVSSAGDVERARILKEEGNELVKKGNHKKAIEKYSESLSFSDIESATYSNRALCHLALKQYKEAVRDC
PVTAQKRWDSSPLEYHKENTKGKFREATTTKGRVSSAGDVERARILKEEGNELVKKGNHKKAIEKYSESLSFSDIESATYSNRALCHLALKQYKEAVRDC
Retrocopy
PVTAQKRWDSSPLEYHKENTKGKFREATTTKGRVSSAGDVERARILKEEGNELVKKGNHKKAIEKYSESLSFSDIESATYSNRALCHLALKQYKEAVRDC


Parental protein
TEALRLDGKNVKAFYRRAQAYKALK-DYKSSFEDINSLLQLEPRNGPAQKLQQEVNQSLN
TEALRLDGKNVKAFYRRAQAYKALK.DYKSSFEDINSLLQLEPRNGPAQKLQQEVNQSLN
Retrocopy
TEALRLDGKNVKAFYRRAQAYKALK/DYKSSFEDINSLLQLEPRNGPAQKLQQEVNQSLN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide