RetrogeneDB ID:
retro_mputfur_823
Organism:
Location:
GL896952.1:8628214-8628553 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
74.34 %
Coverage:
80.71 %
Frameshifts:
0
Stop codons:
2


Parental gene:
Parental gene symbol:
PDZD11
Parental gene aliases:
No gene alias available
Parental gene description:
PDZ domain containing 11 [Source:HGNC Symbol;Acc:28034]

Genomic region (view in browser)





>retro_mputfur_823
CATGAAAGGGTATATTACCCAGGCTACAAAAATGAGTTGATCCAGTTTCTGTCTTGAATT
GTCACACTGAAGAAGCCTCCTGGAACTCAGCTGGGATTTCATATCTGAGGAAGAAAGGTC
TCCCAGCTAGACATTTTTATCTCTAATGTGATTCCTGACTCTGATGCACGTCAAGCAGAA
CTTCAGGAAGGGGACCAAGCCCTAGCTGTGAATGATGTGGTTTTCCAAGATACTGAGCGC
AGCACGGCTAATGAAATCCTAAAGACAGCTTGTGGAATTAGCATGAGTGTCTGCTTCTTT
CTCTATAATTATCATTGCCAAAGAGAGAGGACTGTGCAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
HERVYHPDYNNELTQFLPRIVTLKKPPGAQLGFNIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFF
HERVY.P.Y.NEL.QFL..IVTLKKPPG.QLGF.I.G.K.SQL.IFIS.VIPDSDA..A.LQEGDQ.LAVNDV.FQD.E.S.A.EILKTA..ISM.V.FF
Retrocopy
HERVYYPGYKNELIQFLS*IVTLKKPPGTQLGFHI*GRKVSQLDIFISNVIPDSDARQAELQEGDQALAVNDVVFQDTERSTANEILKTACGISMSVCFF


Parental protein
PYNYHRQKERTVH
.YNYH.Q.ERTVH
Retrocopy
LYNYHCQRERTVH


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide