RetrogeneDB ID:
retro_mputfur_825
Organism:
Location:
GL896952.1:3837066-3837843 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
79.77 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
2


Parental gene:
Parental gene symbol:
PSMA1
Parental gene aliases:
No gene alias available
Parental gene description:
proteasome (prosome, macropain) subunit, alpha type, 1 [Source:HGNC Symbol;Acc:9530]

Genomic region (view in browser)





>retro_mputfur_825
TTTTGCAACCAATATGACAATGAGGTCACTGTATGGAGCACTCAGGGCAGGATTCATCCA
ATTGAGTAGGCAGTGGAAGTTGTCAAACAAGATTCAGCCACAGTTGGTTTGAAATCAAAA
CCTCATGCCGTGTTGGTTGCATTGAAGACAGCACAGTCAGAGCTTGTAACTCAGCAGAAA
AATATTCTCCATGTGGACAAGCATATTGGTATGTCAGTTACAGGACTTACTGCCGATGCT
AGACTGTTCTGTAATGTTATGCTCCAGGAGAGTTTGGATTCCAGATTTGTATTTGACACA
CCTCTTCCTGGGTCTCATCTTGTATCTCTAATTGGAGGCAAGACCCAGACACCAACACAA
CAATATGGCCAGAGACCATATGGTGTTGGACTGCTTATTGCTGGTTATGATGATATGGGC
CCTCACATTTTCCATACCTGTCCATCTGCTAACTATTTTGACTATAGAGTCCTGTCCATT
GGAGCCCGTTCTCTCTCAGCTTGTACTTACCTGGAAAGACACATCTCTGGGTTTATGGAA
TGCAATTTGAATGAACTGGTTAAACGTGTTCTGCATGTCTTACAAGGGACACTTCCTGCA
GAACAGGACCTAACTACAAAGAATGTTTCCATTGGAATTGTTGGTAAAGACTTGGGAGTT
TATGATGATGATGTATCTCCATTCCTGGAAGATCTTGAAGAAAGACCACAGTGAAGGGCA
CAGCCTGCTCAACCTGCTGATGAACCTGTAGAAAGGGCTGATGAACCGATGCAACAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
FRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDR
F.NQYDN.VTVWS.QGRIH.IE.A.E.VKQ.SATVGLKSK.HAVLVALK.AQSEL...QK.ILHVD.HIG.S..GLTADARL.CN.M.QE.LDSRFVFD.
Retrocopy
FCNQYDNEVTVWSTQGRIHPIE*AVEVVKQDSATVGLKSKPHAVLVALKTAQSELVTQQKNILHVDKHIGMSVTGLTADARLFCNVMLQESLDSRFVFDT


Parental protein
PLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSGFMECNLNELVKHGLRALRETLPA
PLP.S.LVSLIG.KTQ.PTQ.YG.RPYGVGLLIAGYDDMGPHIF.TCPSANYFD.R..SIGARS.SA.TYLERH.SGFMECNLNELVK..L..L..TLPA
Retrocopy
PLPGSHLVSLIGGKTQTPTQQYGQRPYGVGLLIAGYDDMGPHIFHTCPSANYFDYRVLSIGARSLSACTYLERHISGFMECNLNELVKRVLHVLQGTLPA


Parental protein
EQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH
EQDLTTKNVSIGIVGKDL....Y.DDDVSPFLE.LEERPQ..AQPAQPADEP.E.ADEPM.H
Retrocopy
EQDLTTKNVSIGIVGKDL--GVY-DDDVSPFLEDLEERPQ*RAQPAQPADEPVERADEPMQH


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide