RetrogeneDB ID:
retro_mputfur_826
Organism:
Location:
GL896952.1:5518282-5518698 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
75.17 %
Coverage:
90.45 %
Frameshifts:
3
Stop codons:
6


Parental gene:
Parental gene symbol:
PIGP
Parental gene aliases:
No gene alias available
Parental gene description:
phosphatidylinositol glycan anchor biosynthesis, class P [Source:HGNC Symbol;Acc:3046]

Genomic region (view in browser)





>retro_mputfur_826
AGACTGTCTAAAGCCTCAGGGAAATGGTGGGAAATTCACCATAACCATTGCCAGAAAGAG
TGATATATGGCTTTGTTCTTTTCTTAAGCTCTCAACTTGGCTTCATACTATATCTTGTGT
GAGCTTTTTATACCTGAATCTTGGCTCAACTCCTTAGGCTTAACCTATTGGCCTCAAAAA
TACTAGGCAATTGCACTACTCATCTACCTCATTACCATAGTAATCAGTTAATGTACTCTT
ATAAACCTGATGAGTACCTCTCCACTCAACTCCATTTATACAATTCCAGGCAACTATGCT
AAAAATCAATAGCAGAAGAAATACCAAGAAGACACCAGCCCACCTTAAGAGATATTCCTA
TTAGTGAAGTAAATTAAATGTTCTTTCTTGCAACCAAAGAACTTTATGTCAAAAAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RLSKATGK-MVENSPSPLPERAIYGFVLFLSSQFGFLLYLVWA-FIPESWLHSLGLTYWPQKYWAVALPVYLLITIVIGYVLLFGINMMSTSPLNSIHTI
RLSKA.GK.MV.NSP.PLPER.IYGFVLFLSSQ.GF.LYLV.A.FIPESWL.SLGLTYWPQKY.A.AL..Y.LITIVI....L..IN.MSTSPLNSI.TI
Retrocopy
RLSKASGK/MVGNSP*PLPERVIYGFVLFLSSQLGFILYLV*A\FIPESWLNSLGLTYWPQKY*AIALLIY-LITIVIS*CTL--INLMSTSPLNSIYTI


Parental protein
TDDYAKNQRQKKYREEAI-PALRDIPISEVNQMFFLATKEPYAKK
...YAKNQ.QKKY.E....P.LRDIPISEVN.MFFLATKE.Y.KK
Retrocopy
PGNYAKNQ*QKKYQEDTS/PTLRDIPISEVN*MFFLATKELYVKK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide