RetrogeneDB ID:
retro_mputfur_829
Organism:
Location:
GL896953.1:64624-65508 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
73.36 %
Coverage:
100.0 %
Frameshifts:
6
Stop codons:
1


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_mputfur_829
ATGTCTCTGTGCCCGTCTCTTGAAGACCTGAAGGTAACAAAGTCATTCAGGCTCAAACTG
CCTTTTCTGCAAACCCTGGCAACCCAGCAATTCTGTCCGAAGCTTCTGCTCCCATCTCTC
AAGACAGAAATCTCTATCCTAGACTGTCCCTGGAGCTCTCCCAGTACATGGGCCTGAGTT
TAAGTGAAGAACAAATCTGTGCACCTATGGCCCTGGGCCCTGGAGCACCAGGTCAGGGGC
AGCTGGCGGCGAGACCTTCCGGTATGAACCCTATGGTGGCCCCGTGACTGGTAATGATGT
TGGAACTCGTAGAACAGAAATGAAGCAAGGGACCCGTGAAGTCATTTTGTGTAAGGATCA
AGATGGAAAAATTGGGCTTGGGCTTAAATCAGTAGATAATGGCATATTTGTTCAGCCGGT
CCAGGCAAATTCTCCAGCCTCACTGGTTGGTCTGAGATTGGGGACCAAGTACTCCAGATC
AGTGGGGAAAGTGTGCAGGCTGGAGCGCTGGTAAAGCACACGAGGTGCCCAAACGAGCTT
TTGGAGAGCAGATTACTAGGACTGTTCATGACAGGCCCTTTGTCGGAGAGTCACCATGCA
TGATGATGGGACTGGACATGCTGGCTTTATCTTTAAAGATGGGGGAAGATCACCTCCACA
GTGAAAGACAGTTCTGCAGCCAGAAAGTCTTCTCACAGAACGTCACATCTGTGAAGTCAA
CGGGCAGAATGTCACCGGGCTGGAGGGTGCTCAAGTGGCAGACGCACCGTCAACATCTGA
GACGGCAGTTACGATGACTCATGCCTGCTTTTATTTCTGAACATATTAAACGGATGGCAC
CAAGCTCTATGAAAAGCCTGACAGATCACACATTTCCTGAGGTT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSLYPSLEDLKV-DKVIQAQTAFSANPGNPAILSEASAPISQDGNLYPKLYPELSQYMGLSLNEEEIRANMAVVPGAPVQGQLVARPSSMNYMVA-PVTG
MSL.PSLEDLKV..KVIQAQTAFSANPGNPAILSEASAPISQD.NLYP.L..ELSQYMGLSL.EE.I.A.MA..PGAP.QGQL.ARPS.MN.MVA.PVTG
Retrocopy
MSLCPSLEDLKV/NKVIQAQTAFSANPGNPAILSEASAPISQDRNLYPRLSLELSQYMGLSLSEEQICAPMALGPGAPGQGQLAARPSGMNPMVA/PVTG


Parental protein
NDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLR-FGDQVLQINGEN-CAGWSSDKAHKVLKQAFGEKITMTVRDRPFE
NDVG.RR.E.KQG.REVILCKDQDGKIGL.LKS.DNGIFVQ.VQANSPASLVGLR..GDQVLQI.GE..CAGWS..KAH.V.K.AFGE.IT.TV.DRPF.
Retrocopy
NDVGTRRTEMKQGTREVILCKDQDGKIGLGLKSVDNGIFVQPVQANSPASLVGLR/IGDQVLQISGES/CAGWSAGKAHEVPKRAFGEQITRTVHDRPFV


Parental protein
-RTVTMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEVNGQNVIGLKDSQIADILSTSETVVTITIMPAFIF-EHIIKRMAPSIMKSLMDHT
.R.VTMH.D.TGH.GFIFK.G...............LLTE..ICEVNGQNV.GL...Q.AD..STSET.VT.T....F.F.EH.IKRMAPS.MKSL.DHT
Retrocopy
/RRVTMHDDGTGHAGFIFKDGGRSPPQ*KTVLQPESLLTERHICEVNGQNVTGLEGAQVADAPSTSETAVTMT-HACFYF\EH-IKRMAPSSMKSLTDHT


Parental protein
IPEV
.PEV
Retrocopy
FPEV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide