RetrogeneDB ID:
retro_mputfur_830
Organism:
Location:
GL896953.1:2364877-2365402 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
96.0 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
Taf9
Parental gene aliases:
No gene alias available
Parental gene description:
TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor [Source:MGI Symbol;Acc:MGI:1888697]

Genomic region (view in browser)





>retro_mputfur_830
GTGAGGACCATGTTGCTTCCGAACATCCTACTCACCGGTACACCAGGGGTTGGAAAAACC
ATGCTAGGCAAAGGACTTGCATCAAGATCAGGACTGAAATACATTAATGTGGGTGATTTA
GCTCGAGAAGGGCAGTTATATGATGGCTATGATGAAGAGTATGAATGCCCCATTTTAGAT
GAAGATAGAGTAGTTGATGAATTGGAAAGCCAAATGAGTGAAGGTGGAGTTATTGTTGAT
TACAATGGTTGTGATTTCTTCCCTGAACGCTGGTTTCATACAGTTTTTGTGCTGCAAGCA
GATAACAGTGTATTGTACAAAAGACTTGAAACAAGGGGTTATAATGAAAAGAAACTAAAA
GACAATATTCAGTGTGAAATTTTTCAAATTCTTTATGAAGAAGCATTAGCATCTTACAAG
GAAGAAATAGTACATCAACTGCCCAGCAATAAACCAGAAGATCTAGAAGATAATATCAAT
CAGATATTGAAGTGGATTAAGCAGTGGATCAAGGATCATAGGTCC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VRTMLLPNILLTGTPGVGKTTLGKELASRSGLKYINVGDLAREGQLYDGYDEEYECPILDEDRVVDELESQMSEGGVIVDYHGCDFFPERWFHIVFVLQA
VRTMLLPNILLTGTPGVGKT.LGK.LASRSGLKYINVGDLAREGQLYDGYDEEYECPILDEDRVVDELESQMSEGGVIVDY.GCDFFPERWFH.VFVLQA
Retrocopy
VRTMLLPNILLTGTPGVGKTMLGKGLASRSGLKYINVGDLAREGQLYDGYDEEYECPILDEDRVVDELESQMSEGGVIVDYNGCDFFPERWFHTVFVLQA


Parental protein
DNSVLYKRLETRGYNEKKLKDNIQCEIFQVLYEEALASYKEEIVHQLPSNKPEDLEDNINQILKWIEQWIKDHSS
DNSVLYKRLETRGYNEKKLKDNIQCEIFQ.LYEEALASYKEEIVHQLPSNKPEDLEDNINQILKWI.QWIKDH.S
Retrocopy
DNSVLYKRLETRGYNEKKLKDNIQCEIFQILYEEALASYKEEIVHQLPSNKPEDLEDNINQILKWIKQWIKDHRS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide