RetrogeneDB ID:
retro_mputfur_833
Organism:
Location:
GL896954.1:4974760-4975271 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
72.57 %
Coverage:
58.11 %
Frameshifts:
2
Stop codons:
3


Parental gene:
Parental gene symbol:
Rpl5
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L5 [Source:MGI Symbol;Acc:MGI:102854]

Genomic region (view in browser)





>retro_mputfur_833
GGGTTTGTTAAGGTTGTCAAGAATAAGGCTTCCTTCAAGAGATACCAAGTGAAATTAAGA
AGACAACGAGAGGGTAAAACTGATTATTATGCCAGGAAATGCTTGGTAAAAGATAAAAGT
AAGTAAAAAACACCTCAATACAGGCGACGGTTCGTGTAACCGACAGAGGTGTCATGTGTC
AGCTTGCTTATGCCTGCAGAGGATACGACGGTTTGGGCACAGCTTACGCTGATGAACTCC
CAAAGTACGGTGGGAAGGTTGGCCTGACAAATTACGCCGCAGCGCACTGTGCCGGCCCGC
TGCTGGCCCACAGGCTCCTCAACAGGTCTGGCATGGACAAGATCTAGGAAGGCCAAGTGG
AAGTGACTGGAGATGAATACAACGGGGAAAGAAGCGTTGATGGTCTACCTGGTCCCGTCA
CCCGCTATCTGGATGCAGGGCTTGCCAGAACTACTGCCGGAAATTAAGTTTTGGGGCCCT
CCAGGGAGCAATGGATGGAGGCCTGCCTATC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRM-IVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYC
GFVKVVKNKA.FKRYQVK.RR.REGKTDYYARK.LV..DK.K..TP.YR...VRVT.R...CQ.AYA...G......AYA.ELPKYG.KVGLTNYAAA.C
Retrocopy
GFVKVVKNKASFKRYQVKLRRQREGKTDYYARKCLV-KDKSK*KTPQYRR/TVRVTDRGVMCQLAYA-CRGYDGLGTAYADELPKYGGKVGLTNYAAAHC


Parental protein
TGLLLARRLLNRFGMDKIYEGQVEVTGDEYNVE-SIDGQPGAFTCYLDAGLARTTTGNKV-FGALKGAVDGGLSI
.G.LLA.RLLNR.GMDKI.EGQVEVTGDEYN.E.S.DG.PG..T.YLDAGLARTT.GN.V.FGAL.GA.DGGL.I
Retrocopy
AGPLLAHRLLNRSGMDKI*EGQVEVTGDEYNGERSVDGLPGPVTRYLDAGLARTTAGN*V/FGALQGAMDGGLPI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide