RetrogeneDB ID:
retro_mputfur_835
Organism:
Location:
GL896954.1:8832164-8832428 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
60.87 %
Coverage:
60.14 %
Frameshifts:
3
Stop codons:
2


Parental gene:
Parental gene symbol:
SSBP1
Parental gene aliases:
No gene alias available
Parental gene description:
single-stranded DNA binding protein 1, mitochondrial [Source:HGNC Symbol;Acc:11317]

Genomic region (view in browser)





>retro_mputfur_835
CAGGTGGAAGAGACACACCCAGTCACAGTAGTTTCTCCAGCAACAGATGAGATGGGGCGT
TGAGGCAATCCTGAAGCATACCAAGGAGGTGATGTCAGTCAAAAGATGACGTGGCACAGA
TACCATCATTCCAGGCAGGTCTCAGAGATGGGCCTATTGGTATATGAAGGATGGTCTGGA
GTTTATGTGGAAGGGACAGTAGGCTATGGGGAGCTCACGGATATGGACAACGGAAGGTGA
CCAGCAACCACAGTCCTCGCTGAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QVEGKNPVTIFSLATNEMWRSGESEAYQMGDVSQKTTWHR-ISVFRPGLRD-VAYQYVKKG-SRIYVEGKVDYGEYTDKNNVRRQATTIIAD
QVE...PVT..S.AT.EM.R.G..EAYQ.GDVSQK.TWHR.I..F..GLRD..AY.Y.K.G.S..YVEG.V.YGE.TD..N.R..ATT..AD
Retrocopy
QVEETHPVTVVSPATDEMGR*GNPEAYQGGDVSQKMTWHR/IPSFQAGLRD/WAYWYMKDG/SGVYVEGTVGYGELTDMDNGR*PATTVLAD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide