RetrogeneDB ID:
retro_mputfur_836
Organism:
Location:
GL896954.1:8916107-8916755 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
91.24 %
Coverage:
99.09 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
HPRT1
Parental gene aliases:
No gene alias available
Parental gene description:
hypoxanthine phosphoribosyltransferase 1 [Source:HGNC Symbol;Acc:5157]

Genomic region (view in browser)





>retro_mputfur_836
ACCCGAAGCCCCAGCATTGTGATTAGTGATGATGAACCAGGTTATGACCTAGATTTATTT
TGTATACCTAATCATTACGCTCAGGATTTGGAAAAGGTGTTTATTCCTCATGGATTAATT
ATGGACAGGACGGAACGGCTTGCGCGAGATGTGATGAAGGAGATGGGAAGCCATCACATT
GTAGCCCTCTGTGTGCTCAAGGGGGGTTATAAATTCTTTGCTGACCTGCTGGATTACATT
AAAGCACTGAACAGAAATAGTGATAGATCCATTCCTATGACTGTAGACTTTATTAGACTG
AAAAGCTACTGTAATGACCAGTCAACAAGGGACATAAAAGTAATTGGTGGAGATGATCTT
TCAACTTTAACTGGAAAGAATGTCTTGATTGTTGAAGATATAATTGAAACAGGCAAAACA
ATGCAAACCTTGCTTTCCTTGGTCCAGCAGTATAATCCAAAGATGGTCAAGGTTGCAAGT
TTGCTGGTGAAAAGGACTCCTCACAGTATTGGATACAGACCAGACTTTGTTGGATTTGAA
ATTCCAGACAAGTTTGTTGTAGGATATGCCCTTGACTATAATGAATATTTCCGGGATTTG
AATCATGTTTGTGTCATTAGTGAAAGTGGAAAAGCAAAATACAAAGCC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SKSPGVYISDDEPGYDLDLFCIPHHYAEDLEKVFIPHGLIMDSRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDGSIPMTVDFIR
..SP...ISDDEPGYDLDLFCIP.HYA.DLEKVFIPHGLIMD.RTERLARDVMKEMG.HHIVALCVLKGGYKFFADLLDYIKALNRNSD.SIPMTVDFIR
Retrocopy
TRSPSIVISDDEPGYDLDLFCIPNHYAQDLEKVFIPHGLIMD-RTERLARDVMKEMGSHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIR


Parental protein
LKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVKEHNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRD
LKSYCNDQST.DIKVIGGDDLSTLTGKNVLIVEDII.TGKTMQTLLSLV...NPKMVKVASLLVKRTP.S.GY.PDFVGFEIPDKFVVGYALDYNEYFRD
Retrocopy
LKSYCNDQSTRDIKVIGGDDLSTLTGKNVLIVEDIIETGKTMQTLLSLVQQYNPKMVKVASLLVKRTPHSIGYRPDFVGFEIPDKFVVGYALDYNEYFRD


Parental protein
LNHVCVISETGKAKYKA
LNHVCVISE.GKAKYKA
Retrocopy
LNHVCVISESGKAKYKA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide