RetrogeneDB ID:
retro_mputfur_839
Organism:
Location:
GL896955.1:1650511-1650860 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
60.16 %
Coverage:
58.17 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
RPL7
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L7 [Source:HGNC Symbol;Acc:10363]

Genomic region (view in browser)





>retro_mputfur_839
AAAGCAAGGAAAAAGCTTATCTTTGAAAACAGTAAACTATCACAAAGACAGATGTACAGA
ACCACTACCAGAATAGCGAGGATGACAAGAAAATTTGGCAACTTCTATGTACCTGCAGAA
CACATATTGACATCTGTCATCACGATCAGTATTAATGGTGTCACCCTAAAGTTCTGGAAG
GTGTTCCAGCTTCTTTGCCTTCACCATATATTCAGTGGTACCTTTGTTAAGCTCAGTGAT
GCTTCAGTTAACATGGTGAAGATTGTGGAACCATATATTGGAAGGGGCGTCCAAACCTGA
AGTCAGTAAATGATGTGTTTTCTTTCACAGTTATGGGAAAACCAGCAAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KARRKLIYEKAKHYHKEYRQMYRTEIRMARMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASVNMLRIVEPYIAWG
KAR.KLI.E..K......RQMYRT..R.ARM.RK.GNFYVPAE..L..VI.I..INGV..K..KV.QLL.L..IF.GTFVKL..ASVNM..IVEPYI..G
Retrocopy
KARKKLIFENSK---LSQRQMYRTTTRIARMTRKFGNFYVPAEHILTSVITI-SINGVTLKFWKVFQLLCLHHIFSGTFVKLSDASVNMVKIVEPYIGRG


Parental protein
Y-PNLKSVNEL-IYKRGYGKINK
..PNLKSVN........YGK..K
Retrocopy
V/PNLKSVNDV/VFFHSYGKTSK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide