RetrogeneDB ID:
retro_mputfur_846
Organism:
Location:
GL896956.1:7602634-7603066 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
64.67 %
Coverage:
76.96 %
Frameshifts:
3
Stop codons:
3


Parental gene:
Parental gene symbol:
NME4
Parental gene aliases:
No gene alias available
Parental gene description:
NME/NM23 nucleoside diphosphate kinase 4 [Source:HGNC Symbol;Acc:7852]

Genomic region (view in browser)





>retro_mputfur_846
CCAAGCCTGCTCTTGGATCCCAGCTCAGGAGGGCCCTCCTGGACCCAGGAATGGACCCTT
GTCATGAAGCCAGATGGGGTGCACTGGTGACTCCTTGTGGATGTGATCCCAAGCTTTGAG
AGAAGGGACTTCAAGCTGATAGAAATGAAGATATTGCAGGCACCAGAGAACATCCTTGCT
GAGCACCACCGTGACCTGAGGAGGAAGACCTTCTACCCAGCCTCATCAGCTACATGAGCT
CTGGCCCCATGGTGGCCGTGGTCTAGAAAGGCCCCAACATGGTCTATGCCTCAGGGGCCA
TGATGGACCCCCAGCTCAGCTGAGGCTGCCCCAGCACCATCAGGGAAGACTTTAGCATCC
ACATCAGCAGAACATCACCCATGCCAGTGACTCCATGGAGGGGGCCCAGAGGAAGACCAA
CTATGGTTCCAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PRLFVRPSSGGASWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFKLVGMKMLQAPERVLAEHYHDLQRKPFYPA-LISYMTSGPVVAMVWEGPNVVGSS
P.L...PSSGG.SWT.E.TLV..KPDGV...L..DVI..FERR.FKL..MK.LQAPE..LAEH..DL.RK.FYPA.LISYM.SGP.VA.V..GPN.V..S
Retrocopy
PSLLLDPSSGGPSWTQEWTLV-MKPDGVHW*LLVDVIPSFERRDFKLIEMKILQAPENILAEHHRDLRRKTFYPA/LISYMSSGPMVAVV*KGPNMVYAS


Parental protein
RAMIGHTDSAEAAPGTIRGDFSIHISR-NIIHASDSVEGAQR-EIQLWFQ
.AM..........P.TIR.DFSIHISR.NI.HASDS.EGAQR.E.QLWFQ
Retrocopy
GAMM-DPQLS*GCPSTIREDFSIHISR/NITHASDSMEGAQR/EDQLWFQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide