RetrogeneDB ID:
retro_mputfur_847
Organism:
Location:
GL896956.1:10525426-10525931 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
82.84 %
Coverage:
63.64 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
RPS3A
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S3A [Source:HGNC Symbol;Acc:10421]

Genomic region (view in browser)





>retro_mputfur_847
CTGCCCAATTTCCATGGCACGGATCTCATCCAGGACAAAATGTGCTCCATGGTCAAAAAA
TGGCAGACCATGATTGAAGCTCATGTTGATGTCAAGACTACCAATGGTTATTTACTTCAT
CTGTTTTGTGTTGATTTTATTAAAAAACGCAATAATCAGATTCAGAAGACCTCTTATGCT
CAGCACCAACAGGTCCGCCAAATTCGGAAAAAGATGATGGAGATCATGACTGAAGAGGTT
CAGACGAATGACTTGAAAGTAGTGGTCAATAAATTGATTCCAGACAGCATTGGAAAAGAT
AGAGAAAAACGTTGTCAGTCTGTTTATCCACTCCATGATGTCTTCGTTAAAAAAGTAAAA
AACGCCGAAGAAGCCCAAGTTTGAATTGGGAAAGCACATGGAGCTTCATGATGAAGGTAG
TAGTTCTGGAAAAGCTACTGGGGATGATACAGGTGCTCAAATTGAACAAGCTGATGGATA
TGAGCTACCAGTCCAGGAATCTGTT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYAQHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKD
L.NFHG.DL..DKMCSMVKKWQTMIEAHVDVKTT.GYLL.LFCV.F.KKRNNQI.KTSYAQHQQVRQIRKKMMEIMT.EVQTNDLK.VVNKLIPDSIGKD
Retrocopy
LPNFHGTDLIQDKMCSMVKKWQTMIEAHVDVKTTNGYLLHLFCVDFIKKRNNQIQKTSYAQHQQVRQIRKKMMEIMTEEVQTNDLKVVVNKLIPDSIGKD


Parental protein
IEKACQSIYPLHDVFVRKVKMLK-KPKFELGKLMELHGEGSSSGKATGDETGAKVERADGYEPPVQESV
.EK.CQS.YPLHDVFV........KPKFELGK.MELH.EGSSSGKATGD.TGA..E.ADGYE.PVQESV
Retrocopy
REKRCQSVYPLHDVFVXXXXXAE\KPKFELGKHMELHDEGSSSGKATGDDTGAQIEQADGYELPVQESV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide