RetrogeneDB ID:
retro_mputfur_851
Organism:
Location:
GL896957.1:2017135-2017514 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
65.65 %
Coverage:
100.0 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
COX5B
Parental gene aliases:
No gene alias available
Parental gene description:
cytochrome c oxidase subunit Vb [Source:HGNC Symbol;Acc:2269]

Genomic region (view in browser)





>retro_mputfur_851
ATGGCTTCGAGGTTACTTCAGGGAGTTGGAGCGCTGGCCATGCAGGCTCTCAGGGTCCAC
GGTCCCAGTGGAGTCACTGTGTTGCACACCATAGCATCTGGAGGTGGTGTTCTTACTAAT
GACCAGGCGACTTGGCTGGAGAGGGAGGTCATGATGGCTGCCAGGAAGGACTGGACCTAT
GCAATATGCTAACCCCAAAGGCAGTTGCAGGCACCAAGGAAGACCCTAATTTAGTCCCAT
CCGTCACCAACAAGCAAATGGCTCCATCTGCAAAGAGGACAATAGTACGGTCATTGGGTT
CTAGTTGCACAAAGGCAAGGTTCAGCGATGCCCTAGCTGTGGAGCCCATTACATGTTGGT
GTCCCACCAGCTGACCCAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MASRLLRGAGALAAQAFRARGPNGVAAVRTMASRGGIPTDDDQATGLEREVMMAARK-GLDPYNLLAPKAAAGTKED-PNLVPSITNKRIVGCICEEDNS
MASRLL.G.GALA.QA.R..GP.GV....T.AS.GG..T.D.QAT.LEREVMMAARK.GLD..N.L.PKA.AGTKED.P...P.I......G.IC.EDNS
Retrocopy
MASRLLQGVGALAMQALRVHGPSGVTVLHTIASGGGVLTND-QATWLEREVMMAARK/GLDLCNMLTPKAVAGTKED/P*FSP-IRHQQANGSICKEDNS


Parental protein
TVIWFWLHKGEAQRCPSCGTHYKLVPHQLAH
TVI.F.LHKG..QRCPSCG.HY.LV.HQL.H
Retrocopy
TVIGF*LHKGKVQRCPSCGAHYMLVSHQLTH


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide