RetrogeneDB ID:
retro_mputfur_852
Organism:
Location:
GL896957.1:5117287-5117642 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
67.21 %
Coverage:
98.36 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
Gm2178
Parental gene aliases:
No gene alias available
Parental gene description:
predicted gene 2178 [Source:MGI Symbol;Acc:MGI:3780348]

Genomic region (view in browser)





>retro_mputfur_852
GCATCCAGAACAGTCCAGCACCTAACATACTACTGTAGACTGTCCTGTGATACAGCTTCT
AGCAAAACTAGGCTGTCCTGAACCGCTGGTGGTAGAATAATTTCACTTTGTACCAAGAGG
GTTGGGAAAGTGCCAAAATCCTTATGTGGCGTGTGCCCAGGCCAATTCGAGGAGTTCGTG
CCGTGAGACCTACCCTTCTTATGAAATTGTCTAAAATGAAAAAACATGTCAGCAGGACCA
GTGGTGGCTCCATGTGTGCTAAGTTTGTTCATGGCAGGATCGAGTGTGCGTTTCTTACTG
AGGACCAGGAAATCATGAAAATGTTGAAGGCACAGCACAGAGTGAGAAAACGAAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AFRMVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGR-LRGVRAVRPKVLMRLSKTKKHVSRAYGGSMCAKCVRDRIKRAFL
A.R.VQ.LTY..RLS..TAS.KTRLS.T.G.RI..L.TK.VGK.PKS.CGVCPG...RGVRAVRP..LM.LSK.KKHVSR..GGSMCAK.V..RI..AFL
Retrocopy
ASRTVQHLTYYCRLSCDTASSKTRLS*TAGGRIISLCTKRVGKVPKSLCGVCPGQ/IRGVRAVRPTLLMKLSKMKKHVSRTSGGSMCAKFVHGRIECAFL


Parental protein
IEEQKIVVKVLKAQ-AQSQKAK
.E.Q.I..K.LKAQ.AQS.K.K
Retrocopy
TEDQEI-MKMLKAQ/AQSEKTK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide