RetrogeneDB ID:
retro_mputfur_854
Organism:
Location:
GL896958.1:2976305-2976692 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
75.97 %
Coverage:
77.25 %
Frameshifts:
0
Stop codons:
2


Parental gene:
Parental gene symbol:
UFC1
Parental gene aliases:
No gene alias available
Parental gene description:
ubiquitin-fold modifier conjugating enzyme 1 [Source:HGNC Symbol;Acc:26941]

Genomic region (view in browser)





>retro_mputfur_854
CTTGTCCAGTATGTAGAAAACAACAAGAATGTAGACAAAGATTGATTCCAACTAGAGTCC
AACAAGGAAGGGCCTCAGTGTTTTGGAAAATGCTGGTATATCCATGATCTCCTCAACTAT
GAGTCTGACATGAAGTTTGACATTCCTATCACATATCCCACTATTGCTCCAGAAATTATA
GCCCCTGAACTCAATGGAAAAACAGCAAAGATATACATGGGGGGCAAAATGTGCCTGACC
AATCACTTTAAGCCTTTCTGGGCCAGGAATGTGCCCAAGTTTGGACTAGCTCATCTCATG
GCTCTGGGGCTGTGTCCATGACTGGTAGTGGAAATCCCCCCTCTAGTTCAGAAAGGTGTG
ATCTGGTGTGAAGAGAAATGCAACCAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKYEFDIEFDIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLM
L..YVENNKN.D.D.F.LESNKEG...FGKCWYIHDLL.YE.D..FDIPITYPT.APEI..PEL.GKTAK.Y.GGK.CLT.HFKP.WARNVPKFGLAHLM
Retrocopy
LVQYVENNKNVDKD*FQLESNKEGPQCFGKCWYIHDLLNYESDMKFDIPITYPTIAPEIIAPELNGKTAKIYMGGKMCLTNHFKPFWARNVPKFGLAHLM


Parental protein
ALGLGPWLAVEIPDLIQKGVIQHKEKCSQ
ALGL.P.L.VEIP.L.QKGVI...EKC.Q
Retrocopy
ALGLCP*LVVEIPPLVQKGVIWCEEKCNQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide