RetrogeneDB ID:
retro_mputfur_856
Organism:
Location:
GL896958.1:2352702-2353175 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
55.28 %
Coverage:
55.05 %
Frameshifts:
3
Stop codons:
5


Parental gene:
Parental gene symbol:
TRNAU1AP
Parental gene aliases:
No gene alias available
Parental gene description:
tRNA selenocysteine 1 associated protein 1 [Source:HGNC Symbol;Acc:30813]

Genomic region (view in browser)





>retro_mputfur_856
GATAGTGGTATGTGGTATGGCTGATCGCCAGCATCCGCCTGTCCTGTTGAAGAGACAATG
TGGTTTTGAATCAGACAGGTTATGTCTAAGGGTTTTGGTTTTATGGAGTTCATGGATGAA
CTTGTACAGAAGCAAACCCCGACAGGATGCCAGGGAACAGTGGGACTGGGGTCCAAACCA
GTGCTTCTGAGTGCAGCAGTCACTAAAGGGAGCTATGTGAAGCCAGTGAAATATAATCAG
TTGTCCATTTGTAGCTAAAACCAGTGTTTCCAGCAGTACCAGACTACCATGCCTAGTGGA
GTTATGACTAGAACACAGGCAACAGCAGCTACAGTTACTCCTCAAACGACTATCCCCAAA
GCTGGACATGGACATAGGAAGAAGTTGAAGGTAATGCCCCCAGTGACCCCAGGCCAGAGC
TCAGTGTGGCCGAGGCCAACAAGGAGTTCATGGAACAGAGAAAGGAGCAGTAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
DDGMLYE-FFVKVYPSCRGGKVVLDQTG-VSKGYGFVKFTDELEQKRALTECQGAVGLGSKPVRLSVAIPKASRVKPVEYSQMYSYSYNQYYQQYQ-NYY
D.GM.Y.........SC....VVL.QTG..SKG.GF..F.DEL.QK...T.CQG.VGLGSKPV.LS.A..K.S.VKPV.Y.Q....S.NQ..QQYQ..Y.
Retrocopy
DSGMWYG/LIASIRLSC*RDNVVLNQTG\MSKGFGFMEFMDELVQKQTPTGCQGTVGLGSKPVLLSAAVTKGSYVKPVKYNQLSICS*NQCFQQYQ/DYH


Parental protein
AQWGYDQNTGSYSYSYPQYGYTQSTMQTYEEVGDDALEDPMPQLDVVEANKEFMEQSEELY
A.W.YD.NTG..SYSY....Y.QS...T.EEV...A..DP.P.L.V.EANKEFMEQ..E.Y
Retrocopy
A*WSYD*NTGNSSYSYSSNDYPQSWTWT*EEVEGNAPSDPRPELSVAEANKEFMEQRKEQY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide