RetrogeneDB ID:
retro_mputfur_857
Organism:
Location:
GL896960.1:2298674-2299098 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
60.54 %
Coverage:
94.19 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
MRPS16
Parental gene aliases:
No gene alias available
Parental gene description:
mitochondrial ribosomal protein S16 [Source:HGNC Symbol;Acc:14048]

Genomic region (view in browser)





>retro_mputfur_857
GGAAACTGTAGAGCTGGGGGATCAGTGCTGGCACCACAGGCCAGCTGCACCAGGGTCCCG
CTCACTGCTGTCCTCTGCAAGGTTTACCACGGAGGCCAGTTAACAGTCCGCCTTGCCCGG
AGTGGCTGTGTCAACCTGCTTCTCCACCACAATGTGGCTGCTTGCAGTAAGTGTTCCAGG
GATGGCTGTTCCGTGGAGCAGTTGGGTTCCTGTGATGCATTGGCCTGCAGTCACGGAGAA
AAAAATACAGAGCAACCTGGACCAGATCCAGCATTGAATCAACTTTGGAGCCCACGTCTC
TAAGCCTGTAGAGTAGCTTTCGGGTATTTCTGGCTTTTCCCCTCTGCATCCCATCATGAT
CACAAATGCTGAGAGGCTGCAAAGGAAATGGGCACAGGAAGTCCTCTTAGTGACTCAGAG
AACA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GGCALGGAASGAQASAHVGCTMVQLTTVLCKAYRGGHLTIRLALSGCTNRPFYRIVAAHNKCPRDGRFVEQLGSYDPLPNSHGE-KIVALNLERIRHWIG
G.C..GG.....QAS....CT.V.LT.VLCK.Y.GG.LT.RLA.SGC.N......VAA..KC.RDG..VEQLGS.D.L..SHGE.KI...NL..I.H.I.
Retrocopy
GNCRAGGSVLAPQAS----CTRVPLTAVLCKVYHGGQLTVRLARSGCVNLLLHHNVAACSKCSRDGCSVEQLGSCDALACSHGE\KIQS-NLDQIQH*IN


Parental protein
CGAHLSKPVEKLLGLSGFFPLHPMMITNAERLRRKRAREVLLASQKT
.GAH.SKPVE.L.G.SGF.PLHP.MITNAERL.RK.A.EVLL..Q.T
Retrocopy
FGAHVSKPVE*LSGISGFSPLHPIMITNAERLQRKWAQEVLLVTQRT


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide