RetrogeneDB ID:
retro_mputfur_861
Organism:
Location:
GL896961.1:6163432-6164538 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
94.32 %
Coverage:
94.62 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
GOT1
Parental gene aliases:
No gene alias available
Parental gene description:
glutamic-oxaloacetic transaminase 1, soluble [Source:HGNC Symbol;Acc:4432]

Genomic region (view in browser)





>retro_mputfur_861
ATGGCGCCTCCGTCTGTGTTCGCCGAGGTTCCGCAGGCCCAGCCGGTCCTGGTCTTTAAG
CTCACTGCTGACTTCTGGGAGGATCCGGACCCCGCAAGGTCAACCTGGGAGTGGGAGCTT
ATCGCACAGATGACTGCCAGCCCTGGGTTTTGCCAGTCGTGAGGAAGGTGGAGCAGAAGC
TCACTAATGACAGCAGTCTGAACCATGAGTATCTGCCTATCCTCGGCCTCAGTGAGTTCC
AGACCTGTGCTTCCCGCCTGGCCCTCGGGGATAACAGCCCAGCTATCCAGGAGAAGCGGG
TTGGAGGTGTGCAGTCTCTAGGGGGGACAGGGGCACTCCGAATTGGAGCCGAGTTCTTAG
CCCGATGGTACAATGGAACCAACAACAAGGATACACCTGTCTATGTGTCCTCACCAACCT
GGGAGAATCATAATGGTGTGTTTTCTGCTGCTGGATTTAAAGACATTCAGTCCTATCACT
ATTGGGATGCAGCGAAGAGAGGACTTGATCTCCAAGGTTTCCTGAATGATCTGAAGAGTG
CCCCCGAGTTCTCCATCTTTGTCCTCCGTGCCTGTGCTCACAACCCAACTGGGACTGACC
CAACTCCGGAGCAGTGGAAGCAGATCGCGTCCATCATGATACGCCGGTTTCTTTTCCCCT
TCTTTGATTCAGCCTATCAGGGCTTTGCATCTGGAGACCTAGAGAAAGATGCCTGGGCCA
TTCGCTATTTCCTGTCTGAAGGATTTGAGCTCTTCTGCGCTCAGTCCTTCTCCAAGAACT
TCGGGCTCTACAATGAGTGAGTGGGCAATCTGACTGTGGTTGCAAAAGATCCTAATAGCA
TCCTGCGGGTCCTTTCCCAGATAGAGAAGATTGTGTGAATTACTTGGTCCAACCCTTCTG
CTCAGGGCGCACGGATTGTGGCCTGTACCCTCTCTAATCCTGAGCTCTTTAAGGAATGGA
CAGGTAATGTGAAGATAATGGCCGACCGGATTCTGACCATGAGATCTGAACTCAGGGCAT
GCTTAGAAGCCCTCAAGACGCCTGGAACCTGGAACCACATCACTGAACATATTGGAATGT
TCAGCTTCACTGGCTTGAACCCCAAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAPPSVFAEVPQAQPVLVFKLTADFREDPDP-RKVNLGVGAYRTDDCQPWVLPVVRKVEQKLANDSSLNHEYLPILGLTEFRTCASRLALGDNSPAIQEK
MAPPSVFAEVPQAQPVLVFKLTADF.EDPDP.RKVNLGVGAYRTDDCQPWVLPVVRKVEQKL.NDSSLNHEYLPILGL.EF.TCASRLALGDNSPAIQEK
Retrocopy
MAPPSVFAEVPQAQPVLVFKLTADFWEDPDP/RKVNLGVGAYRTDDCQPWVLPVVRKVEQKLTNDSSLNHEYLPILGLSEFQTCASRLALGDNSPAIQEK


Parental protein
RVGGVQSLGGTGALRIGAEFLARWYNGTNNKDTPVYVSSPTWENHNGVFSAAGFKDIRSYHYWDAAKRGLDLQGFLNDLESAPEFSIFVLHACAHNPTGT
RVGGVQSLGGTGALRIGAEFLARWYNGTNNKDTPVYVSSPTWENHNGVFSAAGFKDI.SYHYWDAAKRGLDLQGFLNDL.SAPEFSIFVL.ACAHNPTGT
Retrocopy
RVGGVQSLGGTGALRIGAEFLARWYNGTNNKDTPVYVSSPTWENHNGVFSAAGFKDIQSYHYWDAAKRGLDLQGFLNDLKSAPEFSIFVLRACAHNPTGT


Parental protein
DPTPEQWKQIASVMKRRFLFPFFDSAYQGFASGDLEKDAWAVRYFVSEGFELFCAQSFSKNFGLYNERVGNLTVVAKDPDSILRVLSQMEKIVRITWSNP
DPTPEQWKQIAS.M.RRFLFPFFDSAYQGFASGDLEKDAWA.RYF.SEGFELFCAQSFSKNFGLYNE.VGNLTVVAKDP.SILRVLSQ.EKIV.ITWSNP
Retrocopy
DPTPEQWKQIASIMIRRFLFPFFDSAYQGFASGDLEKDAWAIRYFLSEGFELFCAQSFSKNFGLYNE*VGNLTVVAKDPNSILRVLSQIEKIV*ITWSNP


Parental protein
PAQGARIVACTLSNPELFKEWTGNVKTMADRILTMRSELRARLEALKTPGTWNHITEQIGMFSFTGLNRK
.AQGARIVACTLSNPELFKEWTGNVK.MADRILTMRSELRA.LEALKTPGTWNHITE.IGMFSFTGLN.K
Retrocopy
SAQGARIVACTLSNPELFKEWTGNVKIMADRILTMRSELRACLEALKTPGTWNHITEHIGMFSFTGLNPK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide