RetrogeneDB ID:
retro_mputfur_862
Organism:
Location:
GL896961.1:397673-398631 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
77.26 %
Coverage:
81.63 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_mputfur_862
TGGGTCTCGCATAAACCTGAAAGCTGAAAATGAATATGGTATCACCATTGATATCTTCCT
GTGGGAATTTAAAATCAGCAAGTATTATGAGACCATCATTGACATTCCAGGACACAGAGA
CTTTCAAAAACATGAACACACATGCCTCTCAGTCTGACTGTGCTGTCCTGATTTTGTTGC
TGGTATTGGTGAATTTGAAGCAGATATCTCCAAGAATGGGCGGACTCGTGAGCAAGCCCT
TCTGGCTTACACAGTAGGTGTAAAACAACTCATTGTTGGTGTTAACAAAATGGATTCCAC
TGAGCCATCCTATAGCCAGAAGAGATACAAGGAAATCATTAAGGAAGTCAGCACCTACAT
TAAGAAAATTGGCTACAACACCAACACAGTAGCATTTGTGCCAATTTCTGGTTGGAATGG
TGACAATATGCTGGAGCCAAGTGCTAACATGCTGTGGTTCAAGGGATGGAAAGTCACCGA
TAAAGATGGGAATGCCAGTGGGACAACATTGCTTGAAGCTCTGGATTGCATTCTGCCACC
AACTTGTCCAACTGGCAAATACTTGCGTTTCCCTCTCCAGGATGTCAGCAAAATTTGTGC
TATTGGTACTGTCCCTGTGGGCCGAGTGGAGACTGGTATTTTTAAACCTGGCATAGTGGT
CACCTTTGCTCTAGTCAGCGTTATAACTGAAATAAAGTCTGTTGAAATGCACCATCAAGT
TTTGAGTGAGGCTTTTCCTGGGGACAATGTAGGCTTCAATGTCAAGAATGTATCTGTCAA
AGATGTTCATTGTGACAGTGTGACTGATAATGGTCACAATGACCCACCCATGGAAGCAGA
TGGCTTCATGACTCAGGTGATAATCCTGAAAAATCCAGACCACATCAGTGCTGGATATGC
ACCTGTGCTGGATGGTCACATACCTCACATTGCTTGCAAGTTTGCTGAGCTGAAGGAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
WVLDK-LKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMD
WV..K.LKAE.E.GITIDI.LW.F..SKYY.TIID.PGHRDF.K...T..S...C....V.AG.GEFEA.ISKNG.TRE.ALLAYT.GVKQLIVGVNKMD
Retrocopy
WVSHK\LKAENEYGITIDIFLWEFKISKYYETIIDIPGHRDFQKHEHTCLSV*LCCPDFV-AGIGEFEADISKNGRTREQALLAYTVGVKQLIVGVNKMD


Parental protein
STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKI
STEP.YSQKRY.EI.KEVSTYIKKIGYN..TVAFVPISGWNGDNMLEPSANM.WFKGWKVT.KDGNASGTTLLEALDCILPPT.PT.K.LR.PLQDV.KI
Retrocopy
STEPSYSQKRYKEIIKEVSTYIKKIGYNTNTVAFVPISGWNGDNMLEPSANMLWFKGWKVTDKDGNASGTTLLEALDCILPPTCPTGKYLRFPLQDVSKI


Parental protein
GGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAG
..IGTVPVGRVETG..KPG.VVTFA.V.V.TE.KSVEMHH..LSEA.PGDNVGFNVKNVSVKDV....V.....NDPPMEA.GF..QVIIL..P..ISAG
Retrocopy
CAIGTVPVGRVETGIFKPGIVVTFALVSVITEIKSVEMHHQVLSEAFPGDNVGFNVKNVSVKDVHCDSVTDNGHNDPPMEADGFMTQVIILKNPDHISAG


Parental protein
YAPVLDCHTAHIACKFAELKE
YAPVLD.H..HIACKFAELKE
Retrocopy
YAPVLDGHIPHIACKFAELKE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide