RetrogeneDB ID:
retro_mputfur_865
Organism:
Location:
GL896962.1:2988282-2990160 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
83.55 %
Coverage:
99.84 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
CCDC22
Parental gene aliases:
No gene alias available
Parental gene description:
coiled-coil domain containing 22 [Source:HGNC Symbol;Acc:28909]

Genomic region (view in browser)





>retro_mputfur_865
ATGGAGGAGGCAGACCAAATCCTCATCCATTCCCTGCGCCAGGCGGGCACAGCAGTTCCT
CCAGATGTGCAGACCCTGCGAGCCTTTACCCCTGAGTTGGCTGTAGAAACTGTAGTCTGC
TGCCTGCGTGTGATCGACCCTGCCATGGGCTCTGGCCTCAGCCCCCTGCTGCCTCTGGCC
ATGTCCAACCGCTTCCGCCTGGCCGTGAGCCTGGCTCAGGCCTGCAAGGACCTGGGCTAT
TCCTTGGAGCTTGACTATCAGAACTTCCTCTATCCCAGTGAGCCTGATCTCCGGAAGCTG
CTTTTCTTCTTGGCTGAGCGTCTGCCCTCTGATGCCTCTGAGGATGCAGATCAGCCTGCT
AGTGACTCAGCTATTCTTCTCCAGGCCATTGGGGGCCAAATCCGGGACCAGCTGGCCCTT
CCCTGGGTCCCACCCCTCCTTCGTACTCCCAAGCTACAGCACCTCCAGGGTTCAGCCTTC
CAGAAGCCTTTCTACACCACCAGGCTGGTCATGCCTGAGTTGAGTTCCAGCGGGGAACTC
TGGGAGTTCCAGGCGAGTCCTCTGGTGCTACCAGCCCCCACCCAGGTGCCCCAGCCTGCA
GGGAGGGTGGCCTCACTCCTCAAATGCCATGCCATCCAGCTTTGCCAGCACATGGGTGGG
AATCACCTTGGGGATGAGGATTGGGTCCACCGGGCAAGCTGCCATCACACCCAGGAAGAT
CCATGGGCTCAGAGGCAATGGCTACAGAAGTACCTGGCTGATCATCTCTGCCAGACCTGG
GGCCGACTAGGGGCTCCCCCACAAACCGGAGACCTGGGAGAGCTGCTGCAGGCCTGGGGT
GCTGGGGCCAGGACTGGTGCTTCCAAGGCCTCCAACTGCACACACTCAGAGAAGTTCACC
TTTCATCTGGAGTCTGAGATACAGGCAGCCCAGGTGTCTGATGTGTCTGCCACCTCCCAG
TGGCCTGAACAGGACACGAAGGCAGCTCAAGAGCAGGAGCTGGAGTTTCTCCGGGAGCAG
CTAGAGGGAGTGAACCACAGCATTGAAGAGGTTGAAACCAACATGAAGACCCTGGAAATC
AGCTTCATGCAGGTGGAAACCGAGCGTTACCAGAATGAGCTCAGCACTGCGGAGTGTGAG
CAGGCACTGCACTTGAAGAGCCGGGCAGTGGAGCTGCTGCCTGGCGGGGCTGCCAACCTT
GCCAAGCTGCAGCTCATGGTGGAGAGTACTGTCCAGCAGGTCTTCCACTTGGTGGGACAG
TGGGAAAAGCACCGGGTCCCGCTCCTGGCTGAGTACCGCCACCTCCGAAAGCTCCAGGAT
TACAGAGAGTTGGAATCTTCTCGACGGCTGGCAGAGATCCAGGAGCTGCACCAGAGTGTT
CGAGGAGCTGCCAGAGAGGCCCAAAGGAAGGAGGAAGTCTATAAGCAGCTGGTGTCAGAA
CTGGAGAACCTGCCTAGAGATGTGTCCCGGCTTGCCTATACCCAGAGCATCCTGGAGATG
GTGGGCAACATCCGGAAGCAGAAGGAAGAGATCACTAAGATTTTATCAGACACAAAGGAG
CTTCAGAAGGAAATCAGCTCCCTGTCTGGGAAGCTGGATCAGACATTTACAGTGACTGAT
GAGCTTGTGTTCAAGGATGCCAAGAAGGATGATGCCGTTCGGAAGGCATACAAGTATCTA
GCTGCCTTGCATGAGAACTGCAGCCAGCTCATCCAGACCGCTGAGGATGCAGGCACAATC
ATGTGGGAAGCTGGAGATCTTGAAGAGCAGATAGAGACAGAGATGGGGAAGAAGACCCTC
AGCAACCTGGAGAAGATCCGCGAGGACTACCAAGCCCTTTGCCAGGAGAATGCTGGCCTT
TTGGGGTGGATCCCAGAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MEEADRILIHSLRQAGTAVPPDVQTLRAFTTELVVEAVVRCLRVINPAVGSGLSPLLPLAMSARFRLAMSLAQACMDLGYPLELGYQNFLYPSEPDLRDL
MEEAD.ILIHSLRQAGTAVPPDVQTLRAFT.EL.VE.VV.CLRVI.PA.GSGLSPLLPLAMS.RFRLA.SLAQAC.DLGY.LEL.YQNFLYPSEPDLR.L
Retrocopy
MEEADQILIHSLRQAGTAVPPDVQTLRAFTPELAVETVVCCLRVIDPAMGSGLSPLLPLAMSNRFRLAVSLAQACKDLGYSLELDYQNFLYPSEPDLRKL


Parental protein
LLFLAERLPSDASEDADQPAGDSAILLRAIGSQIRDQLALPWVPPLLRTPKLQHLQGSASQKPFHTTRLVLPELSSRGEPREFQASPLLLPAPTQVPQPA
L.FLAERLPSDASEDADQPA.DSAILL.AIG.QIRDQLALPWVPPLLRTPKLQHLQGSA.QKPF.TTRLV.PELSS.GE..EFQASPL.LPAPTQVPQPA
Retrocopy
LFFLAERLPSDASEDADQPASDSAILLQAIGGQIRDQLALPWVPPLLRTPKLQHLQGSAFQKPFYTTRLVMPELSSSGELWEFQASPLVLPAPTQVPQPA


Parental protein
GRVASLLESHAIQLCRHTGRDRPGDEDWVHRAPRHPTQEDTRAQRQRLQKHLAEHLRQTWGRPGAPAQARDLGELLQAWGVGARTGAPKGSRFTHSEKFT
GRVASLL..HAIQLC.H.G....GDEDWVHRA..H.TQED..AQRQ.LQK.LA.HL.QTWGR.GAP.Q..DLGELLQAWG.GARTGA.K.S..THSEKFT
Retrocopy
GRVASLLKCHAIQLCQHMGGNHLGDEDWVHRASCHHTQEDPWAQRQWLQKYLADHLCQTWGRLGAPPQTGDLGELLQAWGAGARTGASKASNCTHSEKFT


Parental protein
FHPEPEVQAAQVCDVPAPSQQPEQDTRAAQEQELESLREQLEGVNRNIEEVEGNMKTLGINLVQVEAERRQSELNVAEREQVLRLKSRAAELLPDGAANL
FH.E.E.QAAQV.DV.A.SQ.PEQDT.AAQEQELE.LREQLEGVN..IEEVE.NMKTL.I...QVE.ER.Q.EL..AE.EQ.L.LKSRA.ELLP.GAANL
Retrocopy
FHLESEIQAAQVSDVSATSQWPEQDTKAAQEQELEFLREQLEGVNHSIEEVETNMKTLEISFMQVETERYQNELSTAECEQALHLKSRAVELLPGGAANL


Parental protein
AKLQLVVESSAQRVIHLAGQWEKHRVPLLAEYRHLRKLQDCRELESSRRLAEIQELHQSVRAAAEEARRKEEVYKQLVSELETLPRDVSRLAYTQRILEI
AKLQL.VES..Q.V.HL.GQWEKHRVPLLAEYRHLRKLQD.RELESSRRLAEIQELHQSVR.AA.EA.RKEEVYKQLVSELE.LPRDVSRLAYTQ.ILE.
Retrocopy
AKLQLMVESTVQQVFHLVGQWEKHRVPLLAEYRHLRKLQDYRELESSRRLAEIQELHQSVRGAAREAQRKEEVYKQLVSELENLPRDVSRLAYTQSILEM


Parental protein
VGNIRKQKEEITKILSDTKELQKEINSLSGKLDRTFAVTDELVFKDAKKDDAVRKAYKYLAALHENCSQLIQTIEDTGTIMREVRDLEEQIETEMGKKTL
VGNIRKQKEEITKILSDTKELQKEI.SLSGKLD.TF.VTDELVFKDAKKDDAVRKAYKYLAALHENCSQLIQT.ED.GTIM.E..DLEEQIETEMGKKTL
Retrocopy
VGNIRKQKEEITKILSDTKELQKEISSLSGKLDQTFTVTDELVFKDAKKDDAVRKAYKYLAALHENCSQLIQTAEDAGTIMWEAGDLEEQIETEMGKKTL


Parental protein
SNLEKIREDYRALRQENASLLGRVRE
SNLEKIREDY.AL.QENA.LLG...E
Retrocopy
SNLEKIREDYQALCQENAGLLGWIPE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide