RetrogeneDB ID:
retro_mputfur_872
Organism:
Location:
GL896963.1:2183946-2184432 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
65.29 %
Coverage:
85.94 %
Frameshifts:
5
Stop codons:
3


Parental gene:
Parental gene symbol:
RAC2
Parental gene aliases:
No gene alias available
Parental gene description:
ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) [Source:HGNC Symbol;Acc:9802]

Genomic region (view in browser)





>retro_mputfur_872
TTCCCAGGAGAATACATCCCCACTGCCTCTGACAATTATTCTGCCAACGTTATGGTAGAT
GGAAAACGGGTGAATCTGGGCTTATGGGATACAGCTAGACAATATAATGATCGATTATGT
CCCTTATCCTATCCACAAACAGATGTGGTCTTAATTTGCTCTTCTCTCGTGAGCCCTGCA
TCATTTGAAAATGTTCAAGCATGGGTACCCTAAAATATGGCACCACTGTCCCAACACCCC
TTCATCCTGGTGGAGTCAAACTTGATCTCAAGGACAATAAAGATGTGATTGAGCAACTGC
AGGAGAAGAAGCCGATTCCCATCACCTAGCCATGAGGTTTGACCATCGCTAAGGACATGG
GTGCTGGAAAACACTAAAGTGCTTGGCTCTCACACAGTGAGGGCTCAAGACAATGTTGGA
TGAAGATCTTCAGGGGTTCTCTGCCCTCCTCCAGTCAAGAAGAGGAAGAGAAAATGCCTG
TTGCTG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
FPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKW-FPEVRHHCPST-PIILV-GTKLDLRDDKD
FPGEYIPT..DNYSANVMVD.K.VNLGLWDTA.Q...DRL.PLSYPQTDV.LIC.SLVSPAS.ENV.A.W..P...HHCP.T.P.ILV.G.KLDL.D.KD
Retrocopy
FPGEYIPTASDNYSANVMVDGKRVNLGLWDTARQYN-DRLCPLSYPQTDVVLICSSLVSPASFENVQA-W\YPKIWHHCPNT/PFILV/GVKLDLKDNKD


Parental protein
TIERLKEKKLAPITYPQGLALAKEIDSVKY-LECSALTQRGLKTVFDEAIR-AVLCPQPVRPQKRPCSIL
.IE.L.EKK..PIT.P.GL..AK.....K..L.C.ALTQ.GLKT..DE.....VLCP.PV...KR.C..L
Retrocopy
VIEQLQEKKPIPIT*P*GLTIAKDMGAGKH/LKCLALTQ*GLKTMLDEDLQ/GVLCPPPVKKRKRKCLLL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide