RetrogeneDB ID:
retro_mputfur_875
Organism:
Location:
GL896963.1:5122891-5123222 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
68.75 %
Coverage:
63.43 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
ZMAT5
Parental gene aliases:
No gene alias available
Parental gene description:
zinc finger, matrin-type 5 [Source:HGNC Symbol;Acc:28046]

Genomic region (view in browser)





>retro_mputfur_875
TCCTTCCAGGACAACCCCCACAACCTCAAGGAGCTCCTGAAGGGGCTGTGGCACTTCCAG
GCCAACAGGGTCTGGTACAACGTGTTCCAAGAGGCGGCGGCCATCTTGCTAGATGCACAG
GACAAGTGAGTGCTATAGGAAGTTTCTACTGACAGGCCAGTGTGCCTTTGGCTCCAACTG
CAGATTTTCCCATATGTCAGAGACAGACCTGCAGGAGCTGAGTATCCAGGTGGAGGAGAG
GCAAACCGGGGAGTGGCCACCAGATGTCCCCAAGTTCCCTGAGAGCCGTCTAGAAGACCA
GTTGGAAAAGAGAGCCAAAGGTTTTGAGTCA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SFQDNLHNRKKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNK-RPCRKFLLTGQCDFGSNCRFSHMSERDLQELSIQVEEERRAREWPLDVVELPEARLE
SFQDN.HN.K..L.GL.H..A..VWY..F..AAAILLD.Q.K....RKFLLTGQC.FGSNCRFSHMSE.DLQELSIQV.EER...EWP.DV...PE.RLE
Retrocopy
SFQDNPHNLKELLKGLWHFQANRVWYNVFQEAAAILLDAQDK\ECYRKFLLTGQCAFGSNCRFSHMSETDLQELSIQV-EERQTGEWPPDVPKFPESRLE


Parental protein
DWLEKRAKRLSS
D.LEKRAK...S
Retrocopy
DQLEKRAKGFES


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide