RetrogeneDB ID:
retro_mputfur_877
Organism:
Location:
GL896963.1:7863002-7863335 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
78.76 %
Coverage:
89.52 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
LAMTOR3
Parental gene aliases:
No gene alias available
Parental gene description:
late endosomal/lysosomal adaptor, MAPK and MTOR activator 3 [Source:HGNC Symbol;Acc:15606]

Genomic region (view in browser)





>retro_mputfur_877
CCACATGTTGAAGGGCTCCATGCTATTGTTGTGTCAGATCGAGACAGAGTCCCTGTTATT
AAGTGGCCAATGATAATGCTCTAGGGCATGCTTAGAGACCTGGTTTCTTATCCATATTTG
CCCTTACAACAGACCAAAGGAGCAAACTTGGACTTCCAAAAAGTGAGAGAATCATCTGTT
ACTGTAACACCTACAAAAGTGGTTCAATTCAATCATTTACCTTTGGCAGTAAGTTTCATA
GCCAGCAGCAATGCCAATACAGGTCTCACTGTCAGCCTAGAAAGGAAACTTGCTCTGTTA
TTTGAAGAACTGAGACAAATTGTGGGAGTTTCT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PSVEGLHAIVVSDRDGVPVIK-VANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQ-VVQFNRLPLVVSFIASSNANTGLIVSLEKELA
P.VEGLHAIVVSDRD.VPVIK.VANDNA..HA.RPGFLS.FAL.TDQ.SKLGL.K...IICY.NTY..VVQFN.LPL.VSFIASSNANTGL.VSLE..LA
Retrocopy
PHVEGLHAIVVSDRDRVPVIK/VANDNALGHA*RPGFLSIFALTTDQRSKLGLPKSERIICYCNTYK\VVQFNHLPLAVSFIASSNANTGLTVSLERKLA


Parental protein
PLFEELRQVVEVS
.LFEELRQ.V.VS
Retrocopy
LLFEELRQIVGVS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide