RetrogeneDB ID:
retro_mputfur_878
Organism:
Location:
GL896963.1:8041655-8042255 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
57.92 %
Coverage:
77.34 %
Frameshifts:
3
Stop codons:
3


Parental gene:
Parental gene symbol:
BSG
Parental gene aliases:
No gene alias available
Parental gene description:
basigin (Ok blood group) [Source:HGNC Symbol;Acc:1116]

Genomic region (view in browser)





>retro_mputfur_878
CTGGAGAAGAAGTATGAGGTGGACTTGGATGACCACTCCAGTGAGTATGCATGCATCTTC
CTCCCAGAGCATTCAGTCAAGACCAGCATTGAAATGAAGGGGCTCCCTAACATCAAGGCC
ACGAATAATTCAGAGCATGCCACTGAGGGGGAGATAGTCATGCTGGGCTGCAAGTTGGAC
TCCTAATCGCTGGTTAGCAACTAGGTGTGGTAAAATTAGTAGCTCCAGGGACCAGGTCCT
CAGTAACTGCTCACAGAGTAAGTCCTTCGTGGTGGCCTTGGAGACCAAGATGGAGCTGCA
TATCTCGAATCTGGATGTTGAGGCAGACCCTGGCAAATATGCCTGCAATGGCACCAACTT
GGAGGGCACCACCAGCCAGACCATCATTGTGCCATATGTGAAAAACCACTTTGCCATGCT
TTTGCCCTTCCTGGGTGTAGTAGTTGAGGTGCTGGTGCTGATCACAAGTTATTTTCATAT
ATGAGAAACGGCAGAAGCTGGACAATGTACTGTAATGATGATGGCATGGGTTCTGTTCCT
CTGAAGAGCACTGGGCATGTGAACAATAAAGGCAAGAACATTTGCTTGAGGAACTCCAAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LKTEFEVDLGERSGEYSCIFLPELAGRTSIQLKGPPNIKAVKRSEHGTERETVVLGCKSESFPPVREWVWYK-MESSGEVISNGSQSKYLVISSETKTEL
L....EVDL...S.EY.CIFLPE....TSI..KG.PNIKA...SEH.TE.E.V.LGCK..S...V...VW.....S...V.SN.SQSK..V...ETK.EL
Retrocopy
LEKKYEVDLDDHSSEYACIFLPEHSVKTSIEMKGLPNIKATNNSEHATEGEIVMLGCKLDS*SLVSN*VW*N\SSSRDQVLSNCSQSKSFVVALETKMEL


Parental protein
HIANLDLEADPGSYACNGTSPEG-TGQAVITLRVRNRFAALWPFLGIVAEVLVLVT-VIFIYEKRRKPDEVL-DDEDAGAAPLKSSGPVNDKGKKVRQRN
HI.NLD.EADPG.YACNGT..EG.T.Q..I...V.N.FA.L.PFLG.V.EVLVL.T.VIFIYEKR.K.D.VL..D...G..PLKS.G.VN.KGK....RN
Retrocopy
HISNLDVEADPGKYACNGTNLEGTTSQTIIVPYVKNHFAMLLPFLGVVVEVLVLIT\VIFIYEKRQKLDNVL\NDDGMGSVPLKSTGHVNNKGKNICLRN


Parental protein
AN
.N
Retrocopy
SN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide