RetrogeneDB ID:
retro_mputfur_881
Organism:
Location:
GL896964.1:6612159-6612516 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
74.79 %
Coverage:
87.5 %
Frameshifts:
0
Stop codons:
2


Parental gene:
Parental gene symbol:
H3F3A
Parental gene aliases:
No gene alias available
Parental gene description:
H3 histone, family 3A [Source:HGNC Symbol;Acc:4764]

Genomic region (view in browser)





>retro_mputfur_881
AGGAAGCCACTGGCTACAAAAACTGCTCTCGAGAATGCGCCCTCTACTGGACAGGTGAAG
AAGCCCCATCATTACAGGCCTGGTACGGGAGCACTCCGTGAAATGAGACATTATCAGAAG
TCCACTGAACTTCTGATCTGCAAACTTCCCTTCCAGCGGCCGGTGTGAGAAACCACTCAG
GACTTCAAAACAGATATGCACTTCTAGAATATAGCTATGGGTGCTTTGCGGAAGGCAAGT
GAGGCCTATCTGGTGAACCTTTCTGAAGACACCAACTGGCATGTTATCCATGCCAAACGT
GTCACAATTATGCCAAAAGACATCCAGCTAGCACGCTGCATACGTGGAGAATGTGCT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKR
RK.LATK.A...APSTG.VKKPH.YRPGT.ALRE.R.YQKSTELLI.KLPFQR.V.E..QDFKTD..F...A.GAL..ASEAYLV.L.EDTN...IHAKR
Retrocopy
RKPLATKTALENAPSTGQVKKPHHYRPGTGALREMRHYQKSTELLICKLPFQRPV*ETTQDFKTDMHF*NIAMGALRKASEAYLVNLSEDTNWHVIHAKR


Parental protein
VTIMPKDIQLARRIRGERA
VTIMPKDIQLAR.IRGE.A
Retrocopy
VTIMPKDIQLARCIRGECA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide