RetrogeneDB ID:
retro_mputfur_882
Organism:
Location:
GL896964.1:266583-266958 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
80.8 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
0610009D07Rik
Parental gene aliases:
No gene alias available
Parental gene description:
RIKEN cDNA 0610009D07 gene [Source:MGI Symbol;Acc:MGI:1913305]

Genomic region (view in browser)





>retro_mputfur_882
ATGGCAATGCAAGCAGCGAAGGGGGGGAACATTCGACTTCCACTTGAAGTAAACTGGGTT
TTATATATAAGAAATTCACCATACAAAATCACAGCTAAAGAAATATATGACATATATGGG
AAATATGGTCCTATTCATCAAACCCAAGTGGGAAACACACCCAAAACTAGAGGGACAGCT
TATGTGATCTATGGAGGTATGTTTGATGCCAAGAATGCATGTGATAACCCTTCAGGATTC
AATGTTTATAACAGATACCTGGTGGTTTTGTACTATAATGCCAACAGGACATTTCAGAAG
ATGAACACAAAAAAGAAGGAAGAGCAGCTGAAGATTCTCAAGGAGAAATATGGTATCAAC
ACAGATCAACCAAAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQK
MAMQAAK..NIRLP.EVN..LYIRN.PYKITA.E.YDI.GKYGPI.Q..VGNTP.TRGTAYV.Y...FDAKNACD..SGFNV.NRYLVVLYYNANR.FQK
Retrocopy
MAMQAAKGGNIRLPLEVNWVLYIRNSPYKITAKEIYDIYGKYGPIHQTQVGNTPKTRGTAYVIYGGMFDAKNACDNPSGFNVYNRYLVVLYYNANRTFQK


Parental protein
MDTKKKEEQLKLLKEKYGINTDPPK
M.TKKKEEQLK.LKEKYGINTD.PK
Retrocopy
MNTKKKEEQLKILKEKYGINTDQPK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide