RetrogeneDB ID:
retro_mputfur_883
Organism:
Location:
GL896964.1:645735-646116 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
58.33 %
Coverage:
80.12 %
Frameshifts:
3
Stop codons:
3


Parental gene:
Parental gene symbol:
TMEM138
Parental gene aliases:
No gene alias available
Parental gene description:
transmembrane protein 138 [Source:HGNC Symbol;Acc:26944]

Genomic region (view in browser)





>retro_mputfur_883
TTTGTTATTTCCTTTGCAGAACTACTCTGAATGGCTCCTATCATCCTGGTGATTGCCGTT
ATCCAGGATACTGCCATTCTCTTCAACATCAGCATCATTTTCCTCCTCTTCTCAGCACAT
TTGTCTTCCAGGCTGGCCTGGGCAACTCTGTATTCCATAAATTCAAATGGACCGCCATCC
TCACAGCTGTGTTCTTCACCCCCAGCATTTTGCTCTATGTCTGGGTCATGACTTAAAGCT
GTAAAAATTCCCAATAGCTTTGTCAGGAGAGAGGGACTTCAAACTCTATATTTCAGAGAC
TAGCACGACAGTGGTACACTGTTATTCTGCAAACGGACAGCTGTGGGACTGGGTAATCCT
CACTTCTACCAGGACTCTTTA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
FVNSFSELLRTAPVIQLVLFIIQDIAILFNIIIIFLMF-FNTFVFQAGLVNLLFHKFKGTIILTAVYFALSISLHVWVMNLRWKNSNRFVWTDGLQT-LF
FV.SF.ELL..AP.I.LV...IQD.AILFNI.IIFL.F...TFVFQAGL.N..FHKFK.T.ILTAV.F..SI.L.VWVM....KNS.......G....L.
Retrocopy
FVISFAELL*MAPII-LVIAVIQDTAILFNISIIFLLF/LSTFVFQAGLGNSVFHKFKWTAILTAVFFTPSILLYVWVMT*SCKNSQ*LCQERGTSN/LY


Parental protein
VFQRLAAVLYCY-FYKRTAVRLGDPRFYQDSL
.......V..CY.F.KRTAV.LG.P.FYQDSL
Retrocopy
ISETSTTVVHCY/FCKRTAVGLGNPHFYQDSL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide