RetrogeneDB ID:
retro_mputfur_885
Organism:
Location:
GL896965.1:6249625-6249892 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
81.32 %
Coverage:
60.96 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
MCFD2
Parental gene aliases:
No gene alias available
Parental gene description:
multiple coagulation factor deficiency 2 [Source:HGNC Symbol;Acc:18451]

Genomic region (view in browser)





>retro_mputfur_885
GCCAGCTTCTCCCATCCTGGTGGCATGGACCTGGATAAGAATCTAGTGCACGACCAAGAG
CATTATCATAAAGCATCTAGAAGGTGTCATCAACATACCAGAAGCAGAGATGTCCCCACA
AGGACTGCAACTCCATTATTTCAAAATGCATGACTATGATGGTCATAATTTGTTTGATGG
ACTAGAACTCTCCACAGCCATCCCTCACGTCCAAAGGACGAAGGGAATGAACAGGTCCCA
CCAATGAGTGAAGCTGAACTGATCAAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ASFSHPGSVGLDKHTVHDQEH-IMEHLEGVINKPEAEMSPQELQLHYFKMHDYDGNNLLDGLELSTAITHVH-KEEGNEQAPPMSEAELIN
ASFSHPG...LDK..VHDQEH.I..HLEGVIN.PEAEMSPQ.LQLHYFKMHDYDG.NL.DGLELSTAI.HV..K.EGNEQ.PPMSEAELIN
Retrocopy
ASFSHPGGMDLDKNLVHDQEH\IIKHLEGVINIPEAEMSPQGLQLHYFKMHDYDGHNLFDGLELSTAIPHVQ/KDEGNEQVPPMSEAELIN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide