RetrogeneDB ID:
retro_mputfur_886
Organism:
Location:
GL896965.1:9092165-9092536 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
79.2 %
Coverage:
54.39 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
METTL21D
Parental gene aliases:
No gene alias available
Parental gene description:
methyltransferase like 21D [Source:HGNC Symbol;Acc:20352]

Genomic region (view in browser)





>retro_mputfur_886
GGGTTTTCTGGCGATGGGGCACACAGTCTGAGCCAGCAGTCAGGGCTGGAGCTGGGCTCC
AGGACTGTGGCTGTGGGATTCATGGTTGCTACTCTCGGGGCTGATGTTGTGGTCACATAT
CTGGAGGAATTGCAAGATTTGCTGAAGATAAATATTAATATGAACAAGCATCTTGTCACT
AGTTCTGTTCAAGCCAAAGTTCTGAAATGGGGGGAAGAAACAGAAGACTTTCCTTCTCCG
TCAGACTTCATACTGATGGCCAACAGCATATACTATGAAAGTCTTTGGAGCCATTGTTGA
AAACTCCAAAAGGTCTTAGTGAATATGAGACTTGAATTATATGTTGTTATGAACAATGAA
CAAGGAGGAAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GFSGDGAHALSRRSVLELGSGTGAVGLMAATLGADVVVTDLEELQDLLKMNINMNKHLVTGSVQAKVLKWGEEIEDFPSPPDYILMADCIYYE-ESLEPL
GFSGDGAH.LS..S.LELGS.T.AVG.M.ATLGADVVVT.LEELQDLLK.NINMNKHLVT.SVQAKVLKWGEE.EDFPSP.D.ILMA..IYYE..SLEPL
Retrocopy
GFSGDGAHSLSQQSGLELGSRTVAVGFMVATLGADVVVTYLEELQDLLKININMNKHLVTSSVQAKVLKWGEETEDFPSPSDFILMANSIYYE/KSLEPL


Parental protein
LKTLKDLSGFETCIICCYEQRTMGK
LKT.K.LS..ET.IICCYEQ.T..K
Retrocopy
LKTPKGLSEYET*IICCYEQ*TRRK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide