RetrogeneDB ID:
retro_mputfur_887
Organism:
Location:
GL896965.1:9190395-9190740 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
79.34 %
Coverage:
90.3 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
TSC22 domain family, member 1 [Source:UniProtKB/TrEMBL;Acc:G9KVG1]

Genomic region (view in browser)





>retro_mputfur_887
TCATTCCCTCGAAAGGCAGTTGGCTCCTCAGTCCTCGTCCTGGAAGCTGAAATCAGCTCC
TCTGGTGCAAGTGTGGTAGCTATTGACAACAAAATCGAGCAAGCTATGGATCTGGTGAAA
AGCCATTTGATGTATGCGGTTAGAGAGGAAGTGGAGGTCCTCAAAGAGCAAATCAAAGAA
CTAATAGAGAAAAATTCCCAGCTGGAGCAGGAAAACAATCTGCTGAAGACACTGGCCAGT
CCTGAGCAGCTTGCCCAATTTCAGGCCCAGCTGCAGACTGGCTCCCCCCCTGCCACCACA
CAGCCCCCCGCCCAGCCAGCGTCCCAGGGCTCAGGACCCACCGCG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATT
SF.....G..........SSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATT
Retrocopy
SFPRKAVGSSVLVLEAEISSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATT


Parental protein
QPQGTTQPPAQPASQGSGPTA
QP....QP..Q....GSGPTA
Retrocopy
QP--PAQPASQ----GSGPTA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide