RetrogeneDB ID:
retro_mputfur_888
Organism:
Location:
GL896965.1:3152697-3153131 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
71.92 %
Coverage:
95.39 %
Frameshifts:
1
Stop codons:
4


Parental gene:
Parental gene symbol:
RPS18
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S18 [Source:HGNC Symbol;Acc:10401]

Genomic region (view in browser)





>retro_mputfur_888
TCTCTAGTGATCCCTGAGAAGTTCCAGCACATTCTGTGAGTATTCAACATCGATATCGAT
GGGAGACAGAAAAGAGCCTTTGCCATCACTGCAATTAAGGGTGTGAGGTGAAGATATGCT
CACATGGTGTTGAGGAAAGCAGACATCGATCTCCCCAAGAGGACAGGAGAGCTCCCCGAG
GATGAGGGGGAATGTGCGATCACCGTTACGCAGCATCTATGCCAATGTAAGACCCCAGGC
TGGCTTCAGACAGATGAAAGGACATGAAGGATGGAAAATATAACCAGGTCCTGGCCAATG
GTCTGGACAACAAACTTTGTGAAGACCTGGAGTGACTGAAGAAGATTCAGGCCCCCCGAG
GGCTGTGTCACTTCTGGGGACTTCGCGTCCAAGGCCAGTGCACCAACACCACAGGCTGCC
ATGGCCACACTGTG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELTEDEVERVITIMQNPRQYKIPDWF-LNRQKDVKDGKYSQVLA
SLVIPEKFQHIL.V.N..IDGR.K.AFAITAIKGV..RYAH.VLRKADIDL.KR.GEL.EDE.E..IT..Q...Q.K.P.W....R.KD.KDGKY.QVLA
Retrocopy
SLVIPEKFQHIL*VFNIDIDGRQKRAFAITAIKGVR*RYAHMVLRKADIDLPKRTGELPEDEGECAITVTQHLCQCKTPGWL/SDR*KDMKDGKYNQVLA


Parental protein
NGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQHTKTTGRRGRTV
NGLDNKL.EDLE.LKKI.A.RGL.HFWGLRV.GQ.T.TTG..G.TV
Retrocopy
NGLDNKLCEDLE*LKKIQAPRGLCHFWGLRVQGQCTNTTGCHGHTV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide