RetrogeneDB ID:
retro_mputfur_893
Organism:
Location:
GL896966.1:8852054-8852500 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
83.33 %
Coverage:
100.0 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
SSBP1
Parental gene aliases:
No gene alias available
Parental gene description:
single-stranded DNA binding protein 1, mitochondrial [Source:HGNC Symbol;Acc:11317]

Genomic region (view in browser)





>retro_mputfur_893
ATGTTTCGAAGACCTGTGTTACAGGTATTTCATCAAGTTTGTAAGGCATGAGTCTGGAAT
AGCTAGCAGCTTGGTTCTGGAAAGATCTCTGAACCGTGTGCAGCTGCTCGGGTGAGTGGG
TCAGGACCCCATAATGAGACAGGTGGAAGGGAAAAGCTCAGTCACGATATGTTCTCTAGT
GACAAATGAGATGTGGTGGTCCGGGGAGAGTGAAGCGTACCAGATGAGTGATGTAAGTCC
AAAGACAACATGGCATAGGATATCAGTATTCCGCCCAGACCTCAGAGGTGGGGTATACCA
GTGTGTCAAAAAGGGGGTCCCGAAGTTATGTAGAAGGGGAAGCAGACTATGGTGAACACA
CGGATAAAAATAATGTGAGGCGGCAAGCAACAACAATCTTAGCTGATAACATTATATTTC
TGAGTGACCAGACCAAAGAGAAGGCA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MFRRPVLQVFHQ-FVRRESEVATSLVLERSLNRVQLLGRVGQDPVMRQVEGKNPVTIFSLATNEMWRSGESEAYQMGDVSQKTTWHRISVFRPGLRDVAY
MFRRPVLQVFHQ.FVR.ES..A.SLVLERSLNRVQLLG.VGQDP.MRQVEGK..VTI.SL.TNEMW.SGESEAYQM.DVS.KTTWHRISVFRP.LR...Y
Retrocopy
MFRRPVLQVFHQ\FVRHESGIASSLVLERSLNRVQLLG*VGQDPIMRQVEGKSSVTICSLVTNEMWWSGESEAYQMSDVSPKTTWHRISVFRPDLRGGVY


Parental protein
QYVKK-GSRIYVEGKVDYGEYTDKNNVRRQATTIIADNIIFLSDQTKEKA
Q.VKK.GSR.YVEG..DYGE.TDKNNVRRQATTI.ADNIIFLSDQTKEKA
Retrocopy
QCVKK\GSRSYVEGEADYGEHTDKNNVRRQATTILADNIIFLSDQTKEKA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide