RetrogeneDB ID:
retro_mputfur_896
Organism:
Location:
GL896967.1:465098-465946 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
77.97 %
Coverage:
86.32 %
Frameshifts:
1
Stop codons:
4


Parental gene:
Parental gene symbol:
CNN3
Parental gene aliases:
No gene alias available
Parental gene description:
calponin 3, acidic [Source:HGNC Symbol;Acc:2157]

Genomic region (view in browser)





>retro_mputfur_896
ACCAACTCTCTGCTGTGCTTAAAAGATGGCACCATCCCCTACGAGCTCATCAACAAGCAA
TAGCCAAGCTCAGTGAAGGTTAATGAGTCCCCATTAAACTGGCCTCAGTTGGAGAATATT
GGCAACTTTATTAAAGCCATCCAGGCTTCTTATGACATGAAGCCACATGACATATCTGAA
GCAAATGATATTTTTGAGACTGGAAACATGACCCAGGTTCAGACTACACTGCTGGCTCTT
GCAGGTCTGGCTAAAATAAAAGGATTCCATACAACCCTTGACATTGGAGTTAAGTAGGCT
GAAAAACAAACAAGACGTTTTGATGAATGAAAATTAAAAGCTGGCCAAAATGTAACTGGT
TTGCAGATGGGAACCAACAAAGGGCACCAGCCACACAGGTATGACAGTATGGGATCAGGA
GGCATCTCTATGATCCCCAAATGCAAACTGACAAACCTACTGACCAGACCACAATTAGTC
TGCAGATGGGCCCCAACAAAGGAGCCAGCCTGGCGGGGATGTTAGCACCAGCTACCAGAG
AAGACATCTATGATCAGAAGCTAACATTACAACCAGCAGACAACGCGACGATGTCTCTAC
ACATGAGAACCAACAAAGTTGCTTCCTGGAAAGGAATGAGTGTGTTTGGGCTTGGGCGGC
AAGTACATGATCCCAAATATGGCACTGCTTCCGCAGAACCTGTCATTCAGAGTGGAAGTC
AAGGGAAAGGAACAAACAGGTCTGAAATTAGTGGTAGTGATTATCAAGCAGAATACCCAG
ATGAATATCACGGTGAGTACCAAGATAACTACCCCCATTACCAATATGGCGACCAAGGCG
CTGATTAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TNFQLGLKDGIILCELINKLQPGSVKKVNESSLNWPQLENIGNFIKAIQA-YGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTTIDIGVKY
TN..L.LKDG.I..ELINK..P.SVK.VNES.LNWPQLENIGNFIKAIQA.Y.MKPHDI.EAND.FE.GNMTQVQTTL.ALAGLAK.KGFHTT.DIGVK.
Retrocopy
TNSLLCLKDGTIPYELINKQ*PSSVK-VNESPLNWPQLENIGNFIKAIQASYDMKPHDISEANDIFETGNMTQVQTTLLALAGLAKIKGFHTTLDIGVK*


Parental protein
AEKQTRRFDEGKLKAGQSVIGLQM-GTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDNSTI
AEKQTRRFDE.KLKAGQ.V.GLQM.G....A.......YG.RRHLYDP.MQTDKP.DQTTISLQMG.NKGAS.AGMLAP.TR.DIYDQKLTLQP.DN.T.
Retrocopy
AEKQTRRFDE*KLKAGQNVTGLQM/GNQQRAPATQV*QYGIRRHLYDPQMQTDKPTDQTTISLQMGPNKGASLAGMLAPATREDIYDQKLTLQPADNATM


Parental protein
SLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPREYQYGDQGIDY
SL.M.TNKVAS.KGMSV.GLGRQV.DPKY..A..EPVI..GSQG.GTN.SEIS.SDYQAEYPDEYHGEYQD.YP..YQYGDQG.DY
Retrocopy
SLHMRTNKVASWKGMSVFGLGRQVHDPKYGTASAEPVIQSGSQGKGTNRSEISGSDYQAEYPDEYHGEYQDNYP-HYQYGDQGADY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide