RetrogeneDB ID:
retro_mputfur_897
Organism:
Location:
GL896967.1:573049-573516 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
66.67 %
Coverage:
98.73 %
Frameshifts:
3
Stop codons:
3


Parental gene:
Parental gene symbol:
RPS11
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S11 [Source:HGNC Symbol;Acc:10384]

Genomic region (view in browser)





>retro_mputfur_897
GACATTCTGATGGAGGACACCCACCAAAACAGCCAACCATCTTTCAAAATAAGAAGAGGG
TCCTGCTTGGAGAAGCTGGCGAGGAGACATTCCCACAAGACTACCAAAACATCGGTCTGA
GTTTCAGGATGCCCAAGAAAAGCCACAGAGGGCACCTATATTGACAAGAAACGCCCCTTC
ACTGGTCATGTCTCTGCTTGAGGATGCATTCTATCTGGTGTGGGGACCAAGAAGAAGATG
CAGAGGGCCACCATCATCCACTGAGACAACCTCCACTACACCCAAAAGTACACCTGCTTT
GAGAAACGCCACAAGAACATGTCTGTGCACCTGTTCTCCTGTTTCAGGGAGCTCCAGATC
AATGACATTGTCATGGTGGGAAATGCTGACTCCTGAGCAAAACTGTAAGCTTCAACGTGC
TCAAAGCCATGAAGGCCACTGGCCCCAACAAGCAATTCCAGGAGTTC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
DIQTERAYQ-KQPTIFQNKKRVLLGETGKEKLPRYYKNIGLGFKTPKE-AIEGTYIDKKCPFTGNVSIRGRILSGVVTKMKMQRTIVIRRDYLHYIRKYN
DI..E...Q.KQPTIFQNKKRVLLGE.G.E..P..Y.NIGL.F..PK..A.EGTYIDKK.PFTG.VS..G.ILSGV.TK.KMQR...I..D.LHY..KY.
Retrocopy
DILMEDTHQ/KQPTIFQNKKRVLLGEAGEETFPQDYQNIGLSFRMPKK\ATEGTYIDKKRPFTGHVSA*GCILSGVGTKKKMQRATIIH*DNLHYTQKYT


Parental protein
RFEKRHKNMSVHLSPCFRDVQIGDIVTV-GECRPLSKTVRFNVLKVTKAAGTKKQFQKF
.FEKRHKNMSVHL..CFR..QI.DIV.V.G.C..LSKTV.FNVLK..KA.G..KQFQ.F
Retrocopy
CFEKRHKNMSVHLFSCFRELQINDIVMV/GKC*LLSKTVSFNVLKAMKATGPNKQFQEF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide