RetrogeneDB ID:
retro_mputfur_898
Organism:
Location:
GL896967.1:5155496-5156176 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
66.52 %
Coverage:
99.56 %
Frameshifts:
5
Stop codons:
5


Parental gene:
Parental gene symbol:
PAFAH1B2
Parental gene aliases:
No gene alias available
Parental gene description:
platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) [Source:HGNC Symbol;Acc:8575]

Genomic region (view in browser)





>retro_mputfur_898
AACCAAGGAGGCTCAAACCCAGTAGCTATTCCACATGCAGTAGAATATATTCAAAGAGAA
GACAGGTAGATGTCTCAGCATAACAGATTTGTCCTGGACTATAAAGACAGTGAATCCGAT
GTACTGTTTGTGGGGGAACTCCATGGTACAGTTGATGCACCAATATGAAGTATGGCAAGA
GCTTTTATCCCCACTTCATATAAGAAATTTTAGAATTGGAGGAGATGCAACAAGACTAGT
TTCATGCAGACTGAAGGATGGAGAACTGGGGAATATTAAACCCAAGGTCATTATTGTCTG
GGAAGGAACAAACAAGCATGAAAACATGGCAGAAGTAGCAGATGGAATTGAAGCTATCAT
ACAACTTATCAACTCAAAGTAGCTGCAGCCAGACTCTTTATACTGGCTTTGTTTCCTTGA
GGTGAGAAACCCAACCATCAGAGGTGAAAGAATGTCAAGGTGAACCAGCTCCTTACATTT
TCTCTGCTGAAACTTGCCTGTGTTCAGCACTGGACGCTGATAGGGTTTTGGGCACTGAGA
GTGTGCCTTCTCCACCTACCACACATTTGATTTTCTGCATCTCACAGGGGGGCAGTTAGA
CAATGTTCTGCAAACTCCTGTGTGAACTCATTATGCAGTTGTTGGAGGAAACACCTGCCA
AGAAACAAAACACCATTGCC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGD-SMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVV
.QG.SNP.AIPHA.E.IQ..DR.MSQHNRFVLD.KD.E.DVLFVG..SMVQLM.QYE.W.EL.SPLH..NF.IGGD.TR.V..RLK.GEL.NIKPKVI.V
Retrocopy
NQGGSNPVAIPHAVEYIQREDR*MSQHNRFVLDYKDSESDVLFVGE\SMVQLMHQYEVWQELLSPLHIRNFRIGGDATRLVSCRLKDGELGNIKPKVIIV


Parental protein
WVGTNNHENTAEEVAGGIEAIVQLINTRQPQ-AKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQ-LLDTDG-GFVHSDGAISCHDMFDFLHL
W.GTN.HEN.A.EVA.GIEAI.QLIN....Q.A....L.L.P.GEKPN..R.KN.KVNQLL..SL.KLA.VQ..LD.D..GF.H...A.S....FDFLHL
Retrocopy
WEGTNKHENMA-EVADGIEAIIQLINSK*LQ/ARLFILALFP*GEKPNHQR*KNVKVNQLLTFSLLKLACVQ/ALDADR/GFGH*ECAFSTYHTFDFLHL


Parental protein
TGGGYAKI-CKPLHELIMQLLEETPEEKQTTIA
TGG......CK.L.ELIMQLLEETP..KQ.TIA
Retrocopy
TGGQLDNV\CKLLCELIMQLLEETPAKKQNTIA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide