RetrogeneDB ID:
retro_mputfur_901
Organism:
Location:
GL896967.1:8021017-8021502 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
78.31 %
Coverage:
79.13 %
Frameshifts:
3
Stop codons:
2


Parental gene:
Parental gene symbol:
BTF3
Parental gene aliases:
No gene alias available
Parental gene description:
basic transcription factor 3 [Source:HGNC Symbol;Acc:1125]

Genomic region (view in browser)





>retro_mputfur_901
AAGATGAAAGGAACTATTATGAACCAGGAGAAACTCACCAAACTGTAAGCCCAAGAGAGC
ACTGGTGGGGAAAGAACTGCTCGCGGAAAGAAGGTGTTTCATAGAACGGCTACAGCAAAT
GATAACAAACTTCAGTTCTCCTTAAAAAGTTAGGGGTAAACAATATCTCGTTATTGAAGA
AGTGAGTATGTTCACAAACCAAGGAACAGTGATCTGCTTTAACAACCCCAAAGTTCAGGC
ATCGCTGGCAGCAAACACTTCTCACCATTACAGGCCACGCTGAGACAAAGCAGCTGACAG
AAATGCTACCCAGGGTCTTAAACCAACTCAGTGCAGACAGTCTGACCAGTTGAAGGAGAC
TGGCTGGAGCCCAGCCCAAACAATGTGTGGTTGGGAAAGCCCTACTTGCTACTGGAGAAG
AGGAGGATGATGAAGTTCCAGATCTTGTGGAGAACTCAGAGGATGCTTCCAAGAAGGAAG
CAAAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QMKETIMNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLK-KLGVNNIS-GIEEVNMFTNQGTVIHFNNPKVQASLAANT-FTITGHAET
.MK.TIMNQEKL.KL.AQ...GG..TAR.KK.V.HRTATA.D.KLQFSLK.KLGVNNIS..IEEV.MFTNQGTVI.FNNPKVQASLAANT..TITGHAET
Retrocopy
KMKGTIMNQEKLTKL*AQESTGGERTARGKK-VFHRTATANDNKLQFSLK/KLGVNNIS/VIEEVSMFTNQGTVICFNNPKVQASLAANT\LTITGHAET


Parental protein
KQLTEMLPSILNQLGADSLTSLRRLAEALPKQSVDGKAPLATGEDDDDEVPDLVENFDEASKNEAN
KQLTEMLP..LNQL.ADSLTS.RRLA.A.PKQ.V.GKA.LATGE..DDEVPDLVEN...ASK.EAN
Retrocopy
KQLTEMLPRVLNQLSADSLTS*RRLAGAQPKQCVVGKALLATGEEEDDEVPDLVENSEDASKKEAN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide