RetrogeneDB ID:
retro_mputfur_902
Organism:
Location:
GL896968.1:1601495-1601812 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
61.11 %
Coverage:
50.71 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
AMTN
Parental gene aliases:
No gene alias available
Parental gene description:
amelotin [Source:HGNC Symbol;Acc:33188]

Genomic region (view in browser)





>retro_mputfur_902
CTGGGGTCAGCTCTGCAGCTGCTAATTCCTGCTACAGGGATGGTACCTGGTACCCAGACC
CTCCCACTGATCCTGGGGGTGTTGAATGCACAACAGCAGCTGTAACCCCAAATGTTGTCA
GTTACTGTAGCACACCTAAGAGCCCAGAGTGTGATCCTAATCTAGGAGGAATTGCCAGTG
GCCCCACAAATCACAGGTCTCATTTCCCTGTCCCTATTCCCAGTAGCTGTTCTGTCTACT
ATTCAGGTTAATGCAGATGCCAAGATGGAATCTTTCCTGCAGGCATCCAAGGAGGCATGC
ACGCTCCCCAGGAAACT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LGSDLQLLNPAAGMPPGPQTLPLSLGVLNTQQQLQSQMLPVIVAHLGAHGAIISSEELPVAPKIFTGLLFQPLFPGSILPTSPANPDA-QNGILPAGQAG
LGS.LQLL.PA.GM.PG.QTLPL.LGVLN.QQQL..QML.V.VAHL.A...I...EELPVAP.I.TGL....LFP...L.T...N.DA.Q.GI.PAG..G
Retrocopy
LGSALQLLIPATGMVPGTQTLPLILGVLNAQQQL*PQMLSVTVAHLRAQSVILI*EELPVAPQI-TGLISLSLFPVAVLSTIQVNADA/QDGIFPAGIQG


Parental protein
VNPAIQGT
...A.Q.T
Retrocopy
GMHAPQET


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide