RetrogeneDB ID:
retro_mputfur_905
Organism:
Location:
GL896969.1:341862-342333 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
71.25 %
Coverage:
61.96 %
Frameshifts:
2
Stop codons:
5


Parental gene:
Parental gene symbol:
STX6
Parental gene aliases:
No gene alias available
Parental gene description:
syntaxin 6 [Source:HGNC Symbol;Acc:11441]

Genomic region (view in browser)





>retro_mputfur_905
ATGTCTATGGAGAACTCCTACTTTGTGAAAGGAGAAGTACAGAAAGCAGTCAACACCATC
CAGGGACTATTCCAGAGATGGACAGAGCTCCTCCAGGACCCCTCCATAGCAACGAGGGAA
GAAATCCACTAGATCACTGATGAGCTGAGGAACAACCTCTGGAGCATAGAATGGGATCTA
GAGGACCTTGATGAGATCATAGCAGAGTTTAAGCAAATGCTAGAAAATTCAAACTCGATG
CAACTGAATGAAGTATAAGATAAACCTTCGTGCCAAGTACTTGGCAGATTGTCAGGGGCA
TGAAGGATCAGATGTCAGCTTCATCTGTGCAGGCATTAGCTGAACCAACGACTAGACAGG
TACGGCCAGTGGACAGTGGTGGCCAGAACTGGACTGCCGGAATACAGAGAAATATACAGA
CACCTCGACCTCGGGCTCTAGTTGGCCAACTCCCATTCTATGATGGAGCAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDLEDLDETI-SIVEANPRKFNLDATELSIRKTFITSTRQVV
MSME...FV.KGEVQKAVNT.QGLFQRWTELLQDPS.ATREEI...T.ELRNNL.SIEWDLEDLDE.I.S.V.AN.RKF.LDATE.SIR.TF..ST.Q.V
Retrocopy
MSMENSYFV-KGEVQKAVNTIQGLFQRWTELLQDPSIATREEIH*ITDELRNNLWSIEWDLEDLDEII/SRV*ANARKFKLDATE*SIR*TFVPSTWQIV


Parental protein
RDMKDQMSASSVQALAERKNRQALLGDSGGQNWSTGT-TDKYGRLDRELQLANSHFIEEQ
R.MKDQMSASSVQALAE...RQ....DSGGQNW..G.....Y..LD..L.LANSH...EQ
Retrocopy
RGMKDQMSASSVQALAEPTTRQVRPVDSGGQNWTAGI\REIYRHLDLGL*LANSHSMMEQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide