RetrogeneDB ID:
retro_mputfur_908
Organism:
Location:
GL896969.1:2966252-2966733 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
61.96 %
Coverage:
76.92 %
Frameshifts:
2
Stop codons:
4


Parental gene:
Parental gene symbol:
RPS8
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S8 [Source:HGNC Symbol;Acc:10441]

Genomic region (view in browser)





>retro_mputfur_908
CCACCTCCCAATGCTAAAAGTGGCCTCCACGACATACACATAATCCGTGCTGGGGAAGAA
GTAAAAAATACCATGCCTTGAGGCCAGATGTGGGGAACTTCTCTTAGGGCTCCCAGTGCT
GTGCGCACAAAATAAGCTGTACTAATGTTGTTTACAATGCATCAAACAGTGAATTGTTCC
ATACTGAGCCCCCAGCGAAGAACAGTATCAGTCTCATGGACAGCACACCGTACTGACAAT
GGTACAAGTTCCATTATGCACACTGCCCCTGGGCCACAAGAAGGGGGCAAAGCTGACTCC
CGAGGAGGAAGAGCTTTTGAACAAAAAATGATCAAAGAGAGTTCAGAAGAAATATGATGA
AAGGAAAAAGAATACCAACATCAGCCTTCTCCTAGAGGAGCAGTTCTAGCCCAGCAAGCT
TCTTGCATGCATTGCAACAAGACCAGACAAGTGTGTCCGAGCAGATGGTGACCAGCTAGA
G


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PAANTKIGPRRIHTVRVR-GGNKKYRALRLDVGNFSWGSECCTRKTRIIDVVYNASNNELVRTKTLVKNCIVLIDSTPYRQWYESHYA-LPLGRKKG-AK
P..N.K.G...IH..R...G..KKY.ALR.DVGNFS.GS.CC..K.....VVYNASN.EL..T....KN.I.L.DSTPY.QWY..HYA..P.....G.AK
Retrocopy
PPPNAKSGLHDIHIIRAG/GRSKKYHALRPDVGNFS*GSQCCAHKISCTNVVYNASNSELFHTEPPAKNSISLMDSTPY*QWYKFHYAHCPWATRRG/AK


Parental protein
LTPEEEEILNKKRSKKIQKKYDERKKNAKISSLLEEQFQQGKLLACIASRPGQCGRADGYVLE
LTPEEEE.LNKK.SK..QKKYDERKKN..IS.LLEEQF...KLLACIA.RP..C.RADG..LE
Retrocopy
LTPEEEELLNKK*SKRVQKKYDERKKNTNISLLLEEQF*PSKLLACIATRPDKCVRADGDQLE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide