RetrogeneDB ID:
retro_mputfur_914
Organism:
Location:
GL896970.1:4305635-4305966 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
61.34 %
Coverage:
72.61 %
Frameshifts:
5
Stop codons:
1


Parental gene:
Parental gene symbol:
RPL24
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L24 [Source:HGNC Symbol;Acc:10325]

Genomic region (view in browser)





>retro_mputfur_914
AGGAATCCTTGGTAGATGCACTGGACTGCCTCTACAGAAGGAGACACAAAAGGGGACAGT
CCGAAGAAATTCAAAAAAGAACCTGCTTTGCAAATTCCAGAGGGCCATGCTCGTGCATCT
CTTGTGACAGAATGGCCGAGAGGAATCCAAAACCCGAAGTTAGGAAGGCTCAACGAGAAC
CAGCCATCTGGGCTGCCAGGGATGCAAAAGAGGCCAACAAGCATCTAACGAGACAGCAGT
GGCTGCTGCTGGGGCTCCCACGAAGGTGGCACCTAAGCAAAAGATGGTGAAGCCTATGAA
GGTTTCTGTTCCTGGCGTAAGTGGCAAACGC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RNPRQINWTV-LYRRKHK-KGQSEEIQKKRTRRAVKFQRAI-TGASLA-DIMAKRNQKPEVRKAQREQAIRAAKEAKKA-KQASKKTAMAAAKAPTKAAP
RNP....WT..LYRR.HK.KG......KK......KFQRA....ASL..D.MA.RN.KPEVRKAQRE.AI.AA..AK.A..QAS..TA.AAA.APTK.AP
Retrocopy
RNPW*MHWTA/LYRRRHK/KGTVRRNSKKNL--LCKFQRAM/ARASLV/DRMAERNPKPEVRKAQREPAIWAARDAKEA/QQASNETAVAAAGAPTKVAP


Parental protein
KQKIVKPVKVSAPRVGGKR
KQK.VKP.KVS.P.V.GKR
Retrocopy
KQKMVKPMKVSVPGVSGKR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide