RetrogeneDB ID:
retro_mputfur_915
Organism:
Location:
GL896970.1:5770679-5771038 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
58.87 %
Coverage:
57.35 %
Frameshifts:
3
Stop codons:
0


Parental gene:
Parental gene symbol:
SNAP23
Parental gene aliases:
No gene alias available
Parental gene description:
synaptosomal-associated protein, 23kDa [Source:HGNC Symbol;Acc:11131]

Genomic region (view in browser)





>retro_mputfur_915
ACAAGAAACTGTGAGTTCAGTAATGCCTACAAGGCAACATGGGACAGATGGTAGAGACAA
ATCTAGCAATGTAGGACCTAAGCACCAGGCCGAATAACAAGTAATCAATTTCCACAAGCG
ACCACTGGAACAGCCAGCAATGGATACATTCAACGTAGAACTAACAATGCCAGAGAAGGT
AAATGGAAGGGAACCTAAGTCAAGTGGGCCGTGTCCCAGGACATCTGAAACACAAGGCCC
TGGACATGGCCAATGAGGTTGAGTCTCCAGATCTACAAATAGGACAGACCACAGAAAAGG
CTGATGTCAATAAAGATAGTATTGAGTTTGCCAAGTCCAGAGCAAAGAAACTCATTGAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TKNFESGKAYKATWG-DGGDNSPSNVVSKQ-PGRVTNGQPQQTTTGAASGGYIKRITNDAREDE-MEENLTQVGSILGNLKNMALDMGNEIEAQNRQIDR
T.N.E...AYKATW..DG.D.S.SNV..K..PGR.T..Q..Q.TTG.AS.GYI.R.TN.ARE...ME.NL.QVG...G.LK..ALDM.NE.E....QI..
Retrocopy
TRNCEFSNAYKATWD\DGRDKS-SNVGPKH/PGRITSNQFPQATTGTASNGYIQRRTNNAREGK/MEGNLSQVGRVPGHLKHKALDMANEVESPDLQIGQ


Parental protein
ITEKADTNKDRIDVANARAKKLID
.TEKAD.NKD.I..A..RAKKLID
Retrocopy
TTEKADVNKDSIEFAKSRAKKLID


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide